CEN/TS 13244-7:2003
(Main)Plastics piping systems for buried and above-ground pressure systems for water for general purposes, drainage and sewerage - Polyethylene (PE) - Part 7: Guidance for the assessment of conformity
General Information
- Abstract
This Part of EN 13244 specifies procedures and requirements for the assessment of conformity to be included in the manufacturer's quality plan as part of his quality system for third party certification of conformity by a certification body accredited to EN 45011 or EN 45012, as appplicable and includes: a) requirements for materials, components, joints and assemblies given in Parts 1 to 5 of EN 13244; b) requirements for the manufacturer's quality system given in EN ISO 9001 or EN ISO 9002, as applicable.
- Status
- Withdrawn
- Publication Date
- 12-Aug-2003
- Withdrawal Date
- 25-Feb-2014
- Technical Committee
- CEN/TC 155 - Plastics piping systems and ducting systems
- Current Stage
- 9960 - Withdrawal effective - Withdrawal
- Start Date
- 26-Feb-2014
- Completion Date
- 26-Feb-2014
- Directive
- Harmonized Standard305/2011 - Regulation (eu) No 305/2011 of the European Parliament and of the Council of 9 march 2011 laying down harmonised conditions for the marketing of construction products and repealing council directive 89/106/eec
Not Harmonized89/106/EEC - Construction products
Relations
- Effective Date
- 20-Feb-2013
- Effective Date
- 25-Aug-2026
- Effective Date
- 25-Aug-2026
- Effective Date
- 25-Aug-2026
- Refers
ISO 3951:1989 - Sampling procedures and charts for inspection by variables for percent nonconforming - Effective Date
- 09-Feb-2026
- Effective Date
- 09-Feb-2026
- Effective Date
- 28-Jan-2026
- Effective Date
- 28-Jan-2026
- Effective Date
- 28-Jan-2026
- Effective Date
- 28-Jan-2026
- Effective Date
- 28-Jan-2026
- Effective Date
- 28-Jan-2026
- Effective Date
- 28-Jan-2026
- Effective Date
- 28-Jan-2026
Get Certified
Connect with accredited certification bodies for this standard
DIBt (Deutsches Institut für Bautechnik)
German Institute for Building Technology.
DIN CERTCO
DIN Group product certification.
Zavod za gradbeništvo Slovenije (ZAG) - Inšpekcija
ZAG inspection body for construction products, structures, and materials.
Sponsored listings
Frequently Asked Questions
CEN/TS 13244-7:2003 is a technical specification published by the European Committee for Standardization (CEN). Its full title is "Plastics piping systems for buried and above-ground pressure systems for water for general purposes, drainage and sewerage - Polyethylene (PE) - Part 7: Guidance for the assessment of conformity". This standard covers: This Part of EN 13244 specifies procedures and requirements for the assessment of conformity to be included in the manufacturer's quality plan as part of his quality system for third party certification of conformity by a certification body accredited to EN 45011 or EN 45012, as appplicable and includes: a) requirements for materials, components, joints and assemblies given in Parts 1 to 5 of EN 13244; b) requirements for the manufacturer's quality system given in EN ISO 9001 or EN ISO 9002, as applicable.
This Part of EN 13244 specifies procedures and requirements for the assessment of conformity to be included in the manufacturer's quality plan as part of his quality system for third party certification of conformity by a certification body accredited to EN 45011 or EN 45012, as appplicable and includes: a) requirements for materials, components, joints and assemblies given in Parts 1 to 5 of EN 13244; b) requirements for the manufacturer's quality system given in EN ISO 9001 or EN ISO 9002, as applicable.
CEN/TS 13244-7:2003 is classified under the following ICS (International Classification for Standards) categories: 23.040.05 - Pipeline and its parts for external sewage systems; 91.140.60 - Water supply systems; 93.030 - External sewage systems. The ICS classification helps identify the subject area and facilitates finding related standards.
CEN/TS 13244-7:2003 has the following relationships with other standards: It is inter standard links to CEN/TS 12201-7:2014, ISO 13955:1997, ISO 13954:1997, ISO 2859-1:1999, ISO 3951:1989, ISO 6259-3:1997, EN 196-1:1994, EN 13244-1:2002, EN ISO 12162:1995, EN 13244-2:2002, EN 13244-3:2002, EN 13244-5:2002, EN ISO 6259-1:2001, EN 13244-4:2002. Understanding these relationships helps ensure you are using the most current and applicable version of the standard.
CEN/TS 13244-7:2003 is associated with the following European legislation: EU Directives/Regulations: 305/2011, 89/106/EEC. When a standard is cited in the Official Journal of the European Union, products manufactured in conformity with it benefit from a presumption of conformity with the essential requirements of the corresponding EU directive or regulation.
CEN/TS 13244-7:2003 is available in PDF format for immediate download after purchase. The document can be added to your cart and obtained through the secure checkout process. Digital delivery ensures instant access to the complete standard document.
Standards Content (Sample)
SLOVENSKI STANDARD
01-maj-2004
&HYQLVLVWHPLL]SROLPHUQLKPDWHULDORYSRG]HPQLLQQDG]HPQL]DWODþQHYRGRYRGH
VSORãQHQDPHPEQRVWLRGYRGQMDYDQMHLQNDQDOL]DFLMR±3ROLHWLOHQ3(GHO
1DYRGLOR]DXJRWDYOMDQMHVNODGQRVWL
Plastics piping systems for buried and above-ground pressure systems for water for
general purposes, drainage and sewerage - Polyethylene (PE) - Part 7: Guidance for the
assessment of conformity
Kunststoff-Rohrleitungssysteme für erd- und oberirdisch verlegte Druckrohrleitungen für
Brauchwasser, Entwässerung und Abwasser - Polyethylen (PE) - Teil 7: Empfehlungen
für die Beurteilung der Konformität
Systemes de canalisations en plastiques pour les applications générales de transport
d'eau, de branchement et de collecteurs d'assainissement, enterrés sous pression -
Polyéthylene (PE) - Partie 7: Guide pour l'évaluation de la conformité
Ta slovenski standard je istoveten z: CEN/TS 13244-7:2003
ICS:
23.040.01 Deli cevovodov in cevovodi Pipeline components and
na splošno pipelines in general
93.030 Zunanji sistemi za odpadno External sewage systems
vodo
2003-01.Slovenski inštitut za standardizacijo. Razmnoževanje celote ali delov tega standarda ni dovoljeno.
TECHNICAL SPECIFICATION
CEN/TS 13244-7
SPÉCIFICATION TECHNIQUE
TECHNISCHE SPEZIFIKATION
August 2003
ICS 93.030
English version
Plastics piping systems for buried and above-ground pressure
systems for water for general purposes, drainage and
sewerage — Polyethylene (PE) — Part 7: Guidance for the
assessment of conformity
Systèmes de canalisations en plastique pour les Kunststoff-Rohrleitungssysteme für erd- und oberirdisch
applications générales de transport d'eau, de branchement verlegte Druckrohrleitungen für Brauchwasser,
et de collecteurs d'assainissement, enterrés sous Entwässerung und Abwasser — Polyethylen (PE) — Teil 7:
pression — Polyéthylène (PE) — Partie 7: Guide pour Empfehlungen für die Beurteilung der Konformität
l'évaluation de la conformité
This Technical Specification (CEN/TS) was approved by CEN on 9 October 2002 for provisional application.
The period of validity of this CEN/TS is limited initially to three years. After two years the members of CEN will be requested to submit their
comments, particularly on the question whether the CEN/TS can be converted into a European Standard.
CEN members are required to announce the existence of this CEN/TS in the same way as for an EN and to make the CEN/TS available. It
is permissible to keep conflicting national standards in force (in parallel to the CEN/TS) until the final decision about the possible
conversion of the CEN/TS into an EN is reached.
CEN members are the national standards bodies of Austria, Belgium, Czech Republic, Denmark, Finland, France, Germany, Greece,
Hungary, Iceland, Ireland, Italy, Luxembourg, Malta, Netherlands, Norway, Portugal, Slovakia, Spain, Sweden, Switzerland and United
Kingdom.
EUROPEAN COMMITTEE FOR STANDARDIZATION
COMITÉ EUROPÉEN DE NORMALISATION
EUROPÄISCHES KOMITEE FÜR NORMUNG
Management Centre: rue de Stassart, 36 B-1050 Brussels
© 2003 CEN All rights of exploitation in any form and by any means reserved Ref. No. CEN/TS 13244-7:2003 E
worldwide for CEN national Members.
Contents
Foreword .3
Introduction .4
1 Scope.5
2 Normative references.5
3 Terms, definitions, symbols and abbreviations.6
3.1 Terms and definitions .6
3.2 Abbreviations.8
4 Requirements.9
4.1 General .9
4.2 Testing and inspection .9
Annex A (normative) Change of PE compound .23
Annex B (normative) Change of design .25
Bibliography .26
Foreword
This document CEN/TS 13244-7:2003 has been prepared by Technical Committee CEN /TC 155,
"Plastics piping systems and ducting systems", the secretariat of which is held by NEN.
This Technical Specification can be used to support the elaboration of national third party certification
procedures for products conforming to the applicable Parts of EN 13244.
This Technical Specification is a Part of a System Standard for plastics piping systems of a particular
material for a specified application. There are a number of such System Standards.
System Standards are based on the results of the work being undertaken in ISO/TC 138 "Plastics
pipes, fittings and valves for the transport of fluids", which is a Technical Committee of the
International Organization for Standardization (ISO).
They are supported by separate standards on test methods to which references are made throughout
the System Standard.
The System Standards are consistent with standards on general functional requirements and
standards on recommended practice for installation.
EN 13244 consists of the following Parts, under the general title "Plastics piping systems for buried
and above-ground pressure systems for water for general purposes, drainage and sewerage —
Polyethylene (PE)".
Part 1: General
Part 2: Pipes
Part 3: Fittings
Part 4: Valves
Part 5: Fitness for purpose of the system
Part 7: Guidance for the assessment of conformity (this technical specification)
NOTE It was decided not to publish a Part 6: Recommended practice for installation. Instead, existing national installation
practices would be applicable.
This Technical Specification includes the following annexes.
Annex A (Normative) Change of PE compound.
Annex B (Normative) Change of design.
Bibliography.
System Standards for piping systems of other plastics materials used for the conveyance of water,
drainage and sewerage under pressure include the following:
EN 1456, Plastics piping systems for buried and above- ground drainage and sewerage under
pressure – Unplasticized poly(vinyl chloride) (PVC-U)
prEN 14364, Plastics piping systems for pressure and non-pressure drainage and sewerage — Glass-
reinforced thermosetting (GRP) plastics based on polyester resin (UP)
According to the CEN/CENELEC Internal Regulations, the national standards organizations of the
following countries are bound to announce this CEN Technical Specification : Austria, Belgium, Czech
Republic, Denmark, Finland, France, Germany, Greece, Hungary, Iceland, Ireland, Italy, Luxembourg,
Malta, Netherlands, Norway, Portugal, Slovakia, Spain, Sweden, Switzerland and the United
Kingdom.
Introduction
The System Standard, of which this is Part 7, specifies the requirements for a piping system and its
components made from polyethylene (PE). It is intended to be used for buried and above-ground
pressure systems for water for general purposes, drainage and sewerage.
This Part of EN 13244 gives guidance for the procedures and requirements for the assessment of
conformity of materials, components, joints and assemblies and is intended to be used by certification
bodies, inspection bodies, testing laboratories and manufacturers.
1 Scope
This Part of EN 13244 gives guidance for the assessment of conformity to be included in the
manufacturer’s quality plan as part of his quality system.
This Technical Specification includes:
a) requirements for materials, components, joints and assemblies given in Parts 1 to 5 of EN 13244;
b) requirements for the manufacturer's quality system;
[1]
NOTE 1 It is recommended that the quality system conforms to EN ISO 9001
c) definitions and procedures to be applied if third party certification is involved.
[2]
NOTE 2 If third party certification is involved, it is recommended that the certification body is accredited to EN 45011 or
[3]
EN 45012 , as applicable.
In conjunction with one or more Parts of EN 13244 (see Foreword) it is applicable to polyethylene
(PE) piping systems intended to be used for buried and above-ground pressure systems for water for
general purposes, drainage and sewerage.
2 Normative references
This Technical Specification incorporates by dated or undated reference, provisions from other
publications. These normative references are cited at the appropriate places in the text, and the
publications are listed hereafter. For dated references, subsequent amendments to or revisions of any
of these publications apply to this Technical Specification only when incorporated in it by amendment
or revision. For undated references the latest edition of the publication referred to applies (including
amendments).
EN 13244-1:2002, Plastics piping systems for buried and above-ground pressure systems for water
for general purposes, drainage and sewerage — Polyethylene (PE) — Part 1: General.
EN 13244-2:2002, Plastics piping systems for buried and above-ground pressure systems for water
for general purposes, drainage and sewerage — Polyethylene (PE) — Part 2: Pipes.
EN 13244-3:2002, Plastics piping systems for buried and above-ground pressure systems for water
for general purposes, drainage and sewerage — Polyethylene (PE) — Part 3: Fittings.
EN 13244-4:2002, Plastics piping systems for buried and above-ground pressure systems for water
for general purposes, drainage and sewerage — Polyethylene (PE) — Part 4: Valves.
EN 13244-5:2002, Plastics piping systems for buried and above-ground pressure systems for water
for general purposes, drainage and sewerage — Polyethylene (PE) — Part 5: Fitness for purpose of
the system.
EN ISO 6259-1:2001, Thermoplastics pipes — Determination of tensile properties – Part 1: General
test method (ISO 6259-1:1997).
EN ISO 12162:1995, Thermoplastics materials for pipes and fittings for pressure applications —
Classification and designation — Overall service (design) coefficient (ISO 12162:1995).
ISO 2859-1:1999, Sampling procedures for inspection by attributes — Part 1: Sampling schemes
indexed by acceptance quality limit (AQL) for lot-by-lot inspection.
ISO 3951:1989, Sampling procedures and charts for inspection by variables for percent
nonconforming.
ISO 6259-3:1997, Thermoplastics pipes — Determination of tensile properties — Part 3: Polyolefin
pipes.
ISO 13954:1997, Plastics pipes and fittings — Peel decohesion test for polyethylene (PE)
electrofusion assemblies of nominal outside diameter greater than or equal to 90 mm.
ISO 13955:1997, Plastics pipes and fittings — Crushing decohesion test for polyethylene (PE)
electrofusion assemblies.
ISO/DIS 13956:1996, Plastics pipes and fittings — Determination of cohesive strength — Tear test
for polyethylene (PE) assemblies.
3 Terms, definitions, symbols and abbreviations
For the purposes of this Technical Specification the terms, definitions, symbols and abbreviations
given in Part 1 and Part 3 to Part 5 of EN 13244, apply together with the following.
3.1 Terms and definitions
3.1.1
certification body
impartial body, governmental or non-governmental, possessing the necessary competence and
responsibility to carry out certification of conformity according to given rules of procedure and
management
3.1.2
inspection body
impartial organisation or company, approved by a certification body as possessing the necessary
competence to verify and/or to carry out initial type testing, witness testing, audit testing and
inspection of the manufacturer's factory production control in accordance with the relevant European
Standard
3.1.3
testing laboratory
laboratory which measures, tests, calibrates or otherwise determines the characteristics of the
performance of materials and products
3.1.4
quality management system
organisational structure, responsibilities, procedures, processes and resources for implementing
[4]
quality management (see EN ISO 9000 )
3.1.5
quality management plan
document setting out the specific quality practices, resources and sequence of activities relevant to a
particular product or range of products
3.1.6
type testing (TT)
tests performed to prove that the material, component, joint or assembly is capable of conforming to
the requirements given in the relevant standard
3.1.7
preliminary type testing (PTT)
type testing carried out by, or on behalf of, the manufacturer
3.1.8
initial type testing (ITT)
type testing carried out by, or on behalf of, a certification body for certification purposes
3.1.9
batch release test (BRT)
test performed by the manufacturer on a batch of components, which has to be satisfactorily
completed before that batch can be released
3.1.10
process verification test (PVT)
test performed by the manufacturer on materials, components, joints or assemblies at specific
intervals to confirm that the process continues to be capable of producing components conforming to
the requirements given in the relevant standard
NOTE Such tests are not required to release batches of components and are carried out as a measure of process control.
3.1.11
audit test (AT)
test performed by, or on behalf of a certification body to confirm that the material, component, joint or
assembly continues to conform to the requirements given in the standard and to provide information
to assess the effectiveness of the quality system
3.1.12
indirect test (IT)
test performed by the manufacturer different from that specified for that particular characteristic,
having verified its correlation with the specified test
3.1.13
witness testing (WT)
testing accepted by an inspection or certification body for initial type testing and/or audit testing, which
is carried out by, or on behalf of, the manufacturer and supervised by a representative of the
inspection or certification body, qualified in testing
3.1.14
material batch
clearly identifiable quantity of a particular material
3.1.15
compound batch
clearly identifiable quantity of a given homogeneous compound manufactured under uniform
conditions. The compound batch is defined and identified by the compound manufacturer
3.1.16
production batch
clearly identifiable collection of units, manufactured consecutively or continuously under the same
conditions, using material or compound conforming to the same specification
3.1.17
pipe batch
number of pipes, all of them the same nominal diameter and nominal wall thickness, extruded from
the same compound on the same machine. The pipe batch is defined and identified by the pipe
manufacturer
3.1.18
fitting or valve batch
number of fittings or valves of the same type, identical dimensional characteristics, all the same
nominal diameter and wall thickness, from the same compound. The fitting or valve batch is defined
and identified by the fitting or valve manufacturer
3.1.19
lot
clearly identifiable sub-division of a batch for inspection purposes
3.1.20
sample
one or more units of product drawn from a batch or lot, selected at random without regard to quality
NOTE The number of units of product in the sample is the sample size.
3.1.21
acceptable quality level (AQL)
when a continuous series of lots or batches is considered, the quality level which for purpose of
sampling inspection is the limit of a satisfactory process average (see ISO 2859-1:1999 and
ISO 3951:1989)
NOTE The designation of an AQL does not imply that a manufacturer has the right knowingly to supply any non-
conforming unit of product.
3.1.22
inspection level
relationship between the lot or batch size and the sample size (see ISO 2859-1:1999)
3.1.23
group
collection of similar components from which samples are selected for testing purposes
3.1.24
product type
pipe or an individual fitting or valve or their main parts, of the same design, from a particular
compound
3.1.25
body type
valve body which can have different end connections
3.1.26
cavity
part of the injection mould which gives the form to the injection moulded product
3.2 Abbreviations
NOTE 1 For reasons of avoiding misunderstanding the following abbreviations are kept the same in each of the languages.
For the same reason the terms are given in the three languages.
NOTE 2 In the French language the abbreviation for "acceptable quality level (AQL)" is NQA, however for the purpose of
this Technical Specification for all three languages the same abbreviation (AQL) is used.
AQL en: acceptable quality level
fr: niveau de qualité acceptable
de: annehmbare Qualitätsgrenzlage
AT en: audit test
fr: essai d’audit
de: Überwachungsprüfung
BRT en: batch release test
fr: essai de libération de campagne de fabrication
de: Freigabeprüfung einer Charge
IT en: indirect test
fr: essai indirect
de: indirekte Prüfung
ITT en: initial type testing
fr: essais de type initiaux
de: Erst-Typprüfung
PTT en: preliminary type testing
fr: essais de type préliminaire
de: vorausgehende Typprüfung
PVT en: process verification test
fr: essai de vérification du procédé de fabrication
de: Prozessüberprüfung
TT en: type test
fr: essai de type
de: Typprüfung
WT en: witness testing
fr: essais témoin
de: Prüfung unter Aufsicht
4 Requirements
4.1 General
4.1.1 Materials, components, joints and assemblies shall conform to the requirements given in
Parts 1 to 5 of EN 13244, as applicable.
4.1.2 Components and/or assemblies shall be produced by the manufacturer under a quality
system which includes a quality plan.
4.2 Testing and inspection
4.2.1 Grouping
For purpose of this Technical Specification the following groups for pipes, fittings and valves given in
Table 1 shall apply.
Table 1 — Size groups for pipes, fittings and valves
Size group
12 3 4
Nominal outside diameter d‡ 32 and < 75‡ 75 and < 250‡ 250 and < 710‡ 710
n
4.2.2 Type tests (TT)
4.2.2.1 General
Type tests shall demonstrate that products conform to all requirements for the characteristics in
Tables 2 to 5 as applicable.
In addition, relevant type tests shall be carried out whenever there is a change in design, in material
and/or in the production method, other than routine in-process adjustments, and to extensions of the
product range.
In the case of change in PE compound as defined in A.2, relevant type tests required for re-evaluation
given in A.3 shall apply.
For the extension of the product range for fittings and valves the relevant characteristics given in
Tables 4 and 5 shall be tested. If applicable the test schedule shall be agreed between the
certification body and the manufacturer.
4.2.2.2 Preliminary type testing (PTT)
The manufacturer shall demonstrate that the products conform to all requirements of the
characteristics given in Tables 3 to 5.
For the purpose of this Technical Specification the compound manufacturer shall demonstrate the
conformity to all requirements given in Table 2.
4.2.2.3 Initial type testing (ITT)
If third party certification is involved the certification body shall assess the conformity of a product to
all requirements for characteristics given in Tables 2 to 5.
In such case, the assessment shall be performed by validation or testing, using the sampling
procedure in Tables 2 to 5 and grouping according to 4.2.1, in an approved testing laboratory or by
witness testing.
Preliminary type test data including long-term characteristics, supplied by the manufacturer and
traceable to material or compound and process, that have been validated by the certification body
shall be taken into account for initial type testing.
NOTE A manufacturer can choose to offer samples for ITT without having previously carried out PTT.
Table 2 — Characteristics that require type testing (TT) of the compound by the compound
manufacturer
Characteristics Reference to Minimum sampling frequency Number of Number of
a
part and samples measurements
clause per sample
Compound density 1 – 4.3 Once per compound 3 1
Carbon black content 1 – 4.3 Once per compound 3 1
Carbon black dispersion 1 – 4.3 Once per compound 1 6
Pigment dispersion 1 – 4.3 Once per compound 1 6
Oxidation induction time 1 – 4.3 Once per compound 3 1
Volatile content 1 – 4.3 Once per compound 1 1
b
Water content 1 – 4.3 Once per compound 1 1
Melt mass-flow rate 1 – 4.3 Once per compound 3 1
Classification 1 – 4.5 Once per compound Shall conform Shall conform to
(pipe d ‡ 32 mm selected from to EN ISO EN ISO
n
size group 1, see Table 1) 12162:1995 12162:1995
Slow crack growth 1 – 4.3 Once per compound 31
(pipe size 110 or 125 SDR 11)
c
Resistance to RCP 1 – 4.3 Once per compound (pipe size 11
250 SDR 11 or 500 SDR 11)
d e e
Resistance to weathering 1 – 4.3 Once per compound 3/3/5 1/1/1
f
Fusion compatibility 1 – 4.4 Once per compound 3 1
a
The number of samples given in the table are the minimum. All samples shall pass the relevant tests.
b
Only applicable if the requirement for volatile content is not conformed to. In case of dispute the requirement for
water content shall apply.
c
To be taken into account for compounds intended to be used in the manufacture of pipes having a wall thickness
‡ 32 mm. Assessment of RCP on compounds for fittings is not applicable.
d
Only for non black compounds. Samples for the OIT test shall be taken from the weathered surface with, the
surface prepared as for jointing. The diameter of the test piece should be included in the test report.
e
Three samples for OIT,/ three samples for hydrostatic strength,/ five samples for elongation at break, with one
measurement on each sample
f
For butt fusion pipe to pipe, both components from the same compound.
Table 3 — Characteristics that require type testing (TT) of the pipe per compound by the pipe
manufacturer
Characteristics Reference Sampling procedure Number of test Number of
a
to part and piece(s) measurements
clause per test piece
Appearance and 2 – 5.1/5.2 Two diameters per size group 1 1
colour
Geometrical 2 – 6. Two diameters per size group 1 1
c
Hydrostatic strength 2 – 7.2 Two diameters per size group 31
20 °C; 100 h
c
Hydrostatic strength 2 – 7.2 Two diameters per size group 31
b
80 °C; 1000 h
d d
Elongation at break 2 – 8.2 Two diameters per size group See note 1
e
Oxidation induction 2 – 8.2 Once per size groups 2, 3 and 4 31
time
Melt mass-flow rate 2 – 8.2 Once per size group 3 1
Marking 2 – 11 Once per size group 1 1
Fitness for purpose For preparation of assemblies, tests and frequency see EN 13244-5
a
The number of test piece(s) given in the table are the minimum. All test pieces shall pass the relevant tests.
b
Attention is drawn to the fact that the test requirements/parameters may be modified when revising this TS when
result of work being undertaken in ISO/TC 138 or CEN/TC 155 is known.
c
If the product range covers more than one size group, samples shall comprise the smallest and largest diameters
man
...



