Avalanche Beacons operating at 457 kHz - Transmitter-receiver systems - Part 1: Harmonised Standard for access to radio spectrum

The present document specifies technical characteristics and methods of measurements for avalanche beacons operating
at 457 kHz transmitter-receiver systems.
NOTE: The relationship between the present document and essential requirements of article 3.2 of Directive
2014/53/EU [i.1] is given in annex A.

Lavinske žolne, ki delujejo v območju 457 kHz - Oddajno-sprejemni sistemi - 1. del: Harmonizirani standard za dostop do radijskega spektra

Ta dokument določa tehnične lastnosti in merilne metode za lavinske žolne, ki delujejo v sistemih oddajnika-sprejemnika pri frekvenci 457 kHz.
OPOMBA: Razmerje med tem dokumentom in bistvenimi zahtevami člena 3.2 Direktive 2014/53/EU [i.1] je podano v dodatku A.

General Information

Status
Published
Public Enquiry End Date
17-Dec-2017
Publication Date
15-Jan-2018
Technical Committee
Current Stage
6060 - National Implementation/Publication (Adopted Project)
Start Date
15-Jan-2018
Due Date
22-Mar-2018
Completion Date
16-Jan-2018
Standard
ETSI EN 300 718-1 V2.1.0 (2017-09) - Avalanche Beacons operating at 457 kHz; Transmitter-receiver systems; Part 1: Harmonised Standard for access to radio spectrum
English language
31 pages
sale 15% off
Preview
sale 15% off
Preview
Standard
ETSI EN 300 718-1 V2.1.1 (2018-01) - Avalanche Beacons operating at 457 kHz; Transmitter-receiver systems; Part 1: Harmonised Standard for access to radio spectrum
English language
31 pages
sale 15% off
Preview
sale 15% off
Preview
Standard
SIST EN 300 718-1 V2.1.1:2018
English language
31 pages
sale 10% off
Preview
sale 10% off
Preview
e-Library read for
1 day

Standards Content (Sample)


Draft ETSI EN 300 718-1 V2.1.0 (2017-09)

HARMONISED EUROPEAN STANDARD
Avalanche Beacons operating at 457 kHz;
Transmitter-receiver systems;
Part 1: Harmonised Standard for access to radio spectrum

2 Draft ETSI EN 300 718-1 V2.1.0 (2017-09)

Reference
REN/ERM-TG28-512-1
Keywords
harmonised standard, radio, testing
ETSI
650 Route des Lucioles
F-06921 Sophia Antipolis Cedex - FRANCE

Tel.: +33 4 92 94 42 00  Fax: +33 4 93 65 47 16

Siret N° 348 623 562 00017 - NAF 742 C
Association à but non lucratif enregistrée à la
Sous-Préfecture de Grasse (06) N° 7803/88

Important notice
The present document can be downloaded from:
http://www.etsi.org/standards-search
The present document may be made available in electronic versions and/or in print. The content of any electronic and/or
print versions of the present document shall not be modified without the prior written authorization of ETSI. In case of any
existing or perceived difference in contents between such versions and/or in print, the only prevailing document is the
print of the Portable Document Format (PDF) version kept on a specific network drive within ETSI Secretariat.
Users of the present document should be aware that the document may be subject to revision or change of status.
Information on the current status of this and other ETSI documents is available at
https://portal.etsi.org/TB/ETSIDeliverableStatus.aspx
If you find errors in the present document, please send your comment to one of the following services:
https://portal.etsi.org/People/CommiteeSupportStaff.aspx
Copyright Notification
No part may be reproduced or utilized in any form or by any means, electronic or mechanical, including photocopying
and microfilm except as authorized by written permission of ETSI.
The content of the PDF version shall not be modified without the written authorization of ETSI.
The copyright and the foregoing restriction extend to reproduction in all media.

© ETSI 2017.
All rights reserved.
TM TM TM
DECT , PLUGTESTS , UMTS and the ETSI logo are trademarks of ETSI registered for the benefit of its Members.
TM
3GPP and LTE™ are trademarks of ETSI registered for the benefit of its Members and
of the 3GPP Organizational Partners.
oneM2M logo is protected for the benefit of its Members.
GSM® and the GSM logo are trademarks registered and owned by the GSM Association.
ETSI
3 Draft ETSI EN 300 718-1 V2.1.0 (2017-09)
Contents
Intellectual Property Rights . 5
Foreword . 5
Modal verbs terminology . 6
1 Scope . 7
2 References . 7
2.1 Normative references . 7
2.2 Informative references . 7
3 Definitions, symbols and abbreviations . 8
3.1 Definitions . 8
3.2 Symbols . 8
3.3 Abbreviations . 9
4 Technical requirements specifications . 9
4.1 Environmental profile . 9
4.2 Conformance requirements for transmitters . 9
4.2.1 Modulation and carrier keying . 9
4.2.1.1 Definition . 9
4.2.1.2 Method of measurement . 9
4.2.1.3 Limits . 9
4.2.2 Frequency error . 10
4.2.2.1 Definition . 10
4.2.2.2 Method of measurement . 10
4.2.2.3 Limits . 10
4.2.3 Output field strength (H-field) . 10
4.2.3.1 Definition . 10
4.2.3.2 Method of measurement . 10
4.2.3.3 Limits . 10
4.2.3.3.1 Minimum transmitted field . 10
4.2.3.3.2 Maximum transmitted field . 10
4.2.4 Transmitter spurious emis sions . 11
4.2.4.1 Definition . 11
4.2.4.2 Radiated H-field . 11
4.2.4.2.1 Method of measurement (< 30 MHz) . 11
4.2.4.2.2 Limits . 11
4.2.4.3 Effective radiated power . 11
4.2.4.3.1 Method of measurement ( ≥ 30 MHz) . 11
4.2.4.3.2 Limits . 12
4.3 Conformance requirements for receivers parameters . 12
4.3.1 Receiver sensitivity . 12
4.3.1.1 Definition . 12
4.3.1.2 Method of measurement . 12
4.3.1.3 Limits . 13
4.3.2 Receiver spurious emissions . 13
4.3.2.1 Definition . 13
4.3.2.2 Radiated H-field . 13
4.3.2.2.1 Method of measurement (< 30 MHz) . 13
4.3.2.2.2 Limits . 13
4.3.2.3 Effective radiated power . 13
4.3.2.3.1 Method of measurement ( ≥ 30 MHz) . 13
4.3.2.3.2 Limits . 14
4.3.3 Receiver blocking . 14
5 Test conditions, power sources and ambient temperatures . 15
5.1 Normal and extreme test conditions . 15
5.2 External test power source. 15
5.3 Normal test conditions . 15
ETSI
4 Draft ETSI EN 300 718-1 V2.1.0 (2017-09)
5.3.1 Normal temperature and humidity . 15
5.3.2 Normal test voltage . 15
5.4 Extreme test conditions . 15
5.4.1 Extreme temperatures . 15
5.4.2 Extreme test voltages . 16
5.4.2.1 General requirement . 16
5.4.2.2. Procedure for tests at extreme temperatures . 16
5.5 Measurement uncertainty . 16
Annex A (informative): Relationship between the present document and the essential
requirements of Directive 2014/53/EU . 17
Annex B (normative): Test sites and general arrangements for measurements involving the
use of radiated fields . 18
B.1 General . 18
B.1.1 Normal test signals . 18
B.1.2 Test fixture . 18
B.1.3 Measuring receiver . 18
B.2 Outdoor test site . 19
B.2.1 General requirements . 19
B.2.2 Standard position . 19
B.3 Test antenna . 20
B.3.1 Below 30 MHz . 20
B.3.2 Above 30 MHz . 20
B.4 Substitution antenna . 20
B.4.1 General . 20
B.4.2 Optional additional indoor site . 21
B.5 Guidance on the use of radiation test sites . 22
B.5.1 General . 22
B.5.2 Measuring distance . 22
B.5.3 Test antenna . 22
B.5.4 Substitution antenna . 22
B.5.5 Artificial antenna . 22
B.5.6 Auxiliary cables . 22
B.6 Further optional alternative indoor test site using an anechoic chamber . 23
B.6.1 General . 23
B.6.2 Example of the construction of a shielded anechoic chamber . 23
B.6.3 Influence of parasitic reflections in anechoic chambers . 23
B.6.4 Calibration of the shielded RF anechoic chamber . 24
Annex C (normative): Spurious limits, radiated H-field at 10 m distances . 26
Annex D (informative): E-fields in the near field at low frequencies . 27
Annex E (informative): Change history . 30
History . 31

ETSI
5 Draft ETSI EN 300 718-1 V2.1.0 (2017-09)
Intellectual Property Rights
Essential patents
IPRs essential or potentially essential to the present document may have been declared to ETSI. The information
pertaining to these essential IPRs, if any, is publicly available for ETSI members and non-members, and can be found
in ETSI SR 000 314: "Intellectual Property Rights (IPRs); Essential, or potentially Essential, IPRs notified to ETSI in
respect of ETSI standards", which is available from the ETSI Secretariat. Latest updates are available on the ETSI Web
server (https://ipr.etsi.org/).
Pursuant to the ETSI IPR Policy, no investigation, including IPR searches, has been carried out by ETSI. No guarantee
can be given as to the existence of other IPRs not referenced in ETSI SR 000 314 (or the updates on the ETSI Web
server) which are, or may be, or may become, essential to the present document.
Trademarks
The present document may include trademarks and/or tradenames which are asserted and/or registered by their owners.
ETSI claims no ownership of these except for any which are indicated as being the property of ETSI, and conveys no
right to use or reproduce any trademark and/or tradename. Mention of those trademarks in the present document does
not constitute an endorsement by ETSI of products, services or organizations associated with those trademarks.
Foreword
This draft Harmonised European Standard (EN) has been produced by ETSI Technical Committee Electromagnetic
compatibility and Radio spectrum Matters (ERM), and is now submitted for the combined Public Enquiry and Vote
phase of the ETSI standards EN Approval Procedure.
The present document has been prepared under the Commission's standardisation request C(2015) 5376 final [i.2] to
provide one voluntary means of conforming to the essential requirements of Directive 2014/53/EU on the harmonisation
of the laws of the Member States relating to the making available on the market of radio equipment and repealing
Directive 1999/5/EC [i.1].
Once the present document is cited in the Official Journal of the European Union under that Directive, compliance with
the normative clauses of the present document given in table A.1 confers, within the limits of the scope of the present
document, a presumption of conformity with the corresponding essential requirements of that Directive and associated
EFTA regulations.
The present document is part 1 of a multi-part deliverable covering avalanche beacons operating at 457 kHz transmitter-
receiver systems, as identified below:
Part 1: "Harmonised standard for access to radio spectrum;"
Part 2: "Harmonised standard for features for emergency services."

National transposition dates
Date of latest announcement of this EN (doa): 3 months after ETSI publication
Date of latest publication of new National Standard
or endorsement of this EN (dop/e): 6 months after doa
Date of withdrawal of any conflicting National Standard (dow): 18 months after doa

ETSI
6 Draft ETSI EN 300 718-1 V2.1.0 (2017-09)
Modal verbs terminology
In the present document "shall", "shall not", "should", "should not", "may", "need not", "will", "will not", "can" and
"cannot" are to be interpreted as described in clause 3.2 of the ETSI Drafting Rules (Verbal forms for the expression of
provisions).
"must" and "must not" are NOT allowed in ETSI deliverables except when used in direct citation.

ETSI
7 Draft ETSI EN 300 718-1 V2.1.0 (2017-09)
1 Scope
The present document specifies technical characteristics and methods of measurements for avalanche beacons operating
at 457 kHz transmitter-receiver systems.
NOTE: The relationship between the present document and essential requirements of article 3.2 of
Directive 2014/53/EU [i.1] is given in annex A.
2 References
2.1 Normative references
References are specific, identified by date of publication and/or edition number or version number. Only the cited
version applies.
Referenced documents which are not found to be publicly available in the expected location might be found at
https://docbox.etsi.org/Reference/.
NOTE: While any hyperlinks included in this clause were valid at the time of publication, ETSI cannot guarantee
their long term validity.
The following referenced documents are necessary for the application of the present document.
[1] CISPR 16-1-1 (2015): " Specification for radio disturbance and immunity measuring apparatus and
methods - Part 1-1: Radio disturbance and immunity measuring apparatus - Measuring apparatus".
[2] CISPR 16-1-4 (2010): "Part 1-4: Radio disturbance and immunity measuring apparatus - Antennas
and test sites for radiated disturbance measurements".
[3] CISPR 16-1-5 (2014): "Specification for radio disturbance and immunity measuring apparatus and
methods; Part 1-5: Radio disturbance and immunity measuring apparatus - Antenna calibration
sites and reference test sites for 5 MHz to 18 GHz".
[4] ETSI EN 300 718-2: "Avalanche Beacons operating at 457 kHz; Transmitter-receiver systems;
Part 2: Harmonised Standard for features for emergency services".
2.2 Informative references
References are either specific (identified by date of publication and/or edition number or version number) or
non-specific. For specific references, only the cited version applies. For non-specific references, the latest version of the
referenced document (including any amendments) applies.
NOTE: While any hyperlinks included in this clause were valid at the time of publication, ETSI cannot guarantee
their long term validity.
The following referenced documents are not necessary for the application of the present document but they assist the
user with regard to a particular subject area.
[i.1] Directive 2014/53/EU of the European Parliament and of the Council of 16 April 2014 on the
harmonisation of the laws of the Member States relating to the making available on the market of
radio equipment and repealing Directive 1999/5/EC.
[i.2] Commission Implementing Decision C(2015) 5376 final of 4.8.2015 on a standardisation request
to the European Committee for Electrotechnical Standardisation and to the European
Telecommunications Standards Institute as regards radio equipment in support of Directive
2014/53/EU of the European Parliament and of the Council.
[i.3] ITU Radio Regulations (2012), Appendix 1 (REV.WRC-12) "Classification of emissions and
necessary bandwidths".
ETSI
8 Draft ETSI EN 300 718-1 V2.1.0 (2017-09)
[i.4] ETSI TR 100 028 (all parts): "Electromagnetic compatibility and Radio spectrum Matters (ERM);
Uncertainties in the measurement of mobile radio equipment characteristics".
3 Definitions, symbols and abbreviations
3.1 Definitions
For the purposes of the present document, the following terms and definitions apply:
avalanche beacons: portable radio systems used for locating avalanche victims, for the purpose of direct rescue
NOTE: I.e. for rescue by comrades not buried by the avalanche.
artificial antenna: tuned reduced-radiating dummy load equal to the nominal impedance specified by the manufacturer
conducted measurements: measurements which are made using a direct connection to the equipment under test
E-field: electric component of the field measured as voltage per unit length
environmental profile: range of environmental conditions under which equipment within the scope of the present
document is required to comply with the provisions of the present document
H-field: magnetic component of the field measured as current per unit length
H-field test antenna: electrically screened loop or equivalent antenna, with which the magnetic component of the field
can be measured
integral antenna: antenna designed as an indispensable part of the equipment, with or without the use of an antenna
connector
radiated measurements: measurements which involve the absolute measurement of a radiated field
(S + N)/N: ratio, expressed in Decibels, between the sum of the wanted signal plus the noise floor and the noise floor
3.2 Symbols
For the purposes of the present document, the following abbreviations apply:
A1A Class of emission
NOTE: See ITU Radio Regulations [i.3].
E Electrical field strength
Eo Reference electrical field strength
NOTE: See annex B.
f Frequency
H Magnetic field strength
Ho Reference magnetic field strength
NOTE: See annex B.
N Newton
P Power
R Distance
Ro Reference distance
NOTE: See annex B
t Time
Z Wave impedance
ETSI
9 Draft ETSI EN 300 718-1 V2.1.0 (2017-09)
l Wavelength
NOTE: See annex B
3.3 Abbreviations
For the purposes of the present document, the following abbreviations apply:
RF Radio Frequency
4 Technical requirements specifications
4.1 Environmental profile
The technical requirements of the present document apply under the environmental profile for operation of the
equipment, which shall be declared by the manufacturer. The equipment shall comply with all the technical
requirements of the present document which are identified as applicable in annex A at all times when operating within
the boundary limits of the declared operational environmental profile.
4.2 Conformance requirements for transmitters
4.2.1 Modulation and carrier keying
4.2.1.1 Definition
The modulation is the method for generating the RF carrier. The carrier keying defines the on and off times for a
non-continuous carrier.
4.2.1.2 Method of measurement
The carrier keying shall be measured by means of an oscilloscope connected to a suitable coil antenna. The
measurements shall be done under normal as well as under extreme test conditions.
4.2.1.3 Limits
The modulation shall be of type A1A, i.e. double sideband amplitude modulation with no modulating auxiliary carrier,
as used for telegraphy.
The carrier keying shall be as shown in figure 1:
• on time: 70 ms minimum;
• off time: 400 ms minimum;
• period: 1 000 ms ± 300 ms (on time plus off time).
ETSI
10 Draft ETSI EN 300 718-1 V2.1.0 (2017-09)

1 000 ± 300 ms
status
70 ms
≥
≥ 400 ms
on
time
off
Figure 1
4.2.2 Frequency error
4.2.2.1 Definition
The frequency error of the transmitter system is the difference between the measured carrier frequency and the nominal
carrier frequency.
4.2.2.2 Method of measurement
The carrier frequency shall be measured by means of a test fixture (see annex B, clause B.1.2). The measurements shall
be done under normal as well as under extreme test conditions as defined in clause 5.
4.2.2.3 Limits
The frequency error shall not exceed ±80 Hz at 457 kHz.
4.2.3 Output field strength (H-field)
4.2.3.1 Definition
The H-field is measured in the direction of maximum field strength under specified conditions of measurement.
4.2.3.2 Method of measurement
The H-field produced by the equipment shall be measured on the axis of the transmitting antenna at distances of 10 m
on an outdoor test site (see annex B).
4.2.3.3 Limits
4.2.3.3.1 Minimum transmitted field
The minimum transmitted field strength at 457 kHz shall not be lower than -6 dBμA/m (0,5 μA/m) at a distance of
10 m.
4.2.3.3.2 Maximum transmitted field
The maximum transmitted field strength at 457 kHz shall not exceed 7 dBμA/m (2,23 μA/m) at a distance of 10 m.
ETSI
11 Draft ETSI EN 300 718-1 V2.1.0 (2017-09)
4.2.4 Transmitter spurious emissions
4.2.4.1 Definition
Spurious emissions are emissions at frequencies other than those of the carrier and sidebands associated with normal
modulation. The level of spurious emissions shall be measured at normal conditions as their effective radiated power or
field strength radiated by the cabinet and the integral antenna.
4.2.4.2 Radiated H-field
4.2.4.2.1 Method of measurement (< 30 MHz)
The field strength shall be measured for frequencies below 30 MHz. The equipment under test shall be measured at a
distance of 10 m on an outdoor test site. The test antenna shall be a calibrated shielded magnetic field antenna. The
equipment under test and test antenna shall be arranged as stated in annex B, clause B.2.
The equipment under test shall be switched on in transmit mode (see clause 4.2). The measuring receiver shall be tuned
over the frequency range 9 kHz to 30 MHz, except for the frequency band ±20 kHz from the frequency on which the
transmitter is intended to operate.
At each frequency at which a spurious signal is detected the equipment under test and the test antenna shall be rotated
until maximum field strength is indicated on the measuring receiver. This level shall be noted.
The limits are quoted in dBμA or dBμA/m, so it is necessary to reduce the reading as explained in annex D for
measuring equipment calibrated in dBμV or dBμV/m.
4.2.4.2.2 Limits
Radiated emissions below 30 MHz shall not exceed the generated H-field at 10 m given in table 2.
Table 2
State Frequency 9 kHz ≤ f < 10 MHz Frequency 10 MHz ≤ f < 30 MHz
Transmit
27 dBμA/m descending 3 dB/oct -3,5 dBμA/m

A graphical representation is shown in annex C, figure C.1.
4.2.4.3 Effective radiated power
4.2.4.3.1 Method of measurement ( ≥ 30 MHz)
On a test site, selected from annex B, the equipment shall be placed at the specified height on a non-conducting support
and in the position closest to normal use as declared by the manufacturer.
The test antenna shall be oriented for vertical polarization. The output of the test antenna shall be connected to a
measuring receiver.
The equipment shall be switched on in transmit mode, and the measuring receiver shall be tuned over the frequency
range 30 MHz to 1 000 MHz.
At each frequency at which a spurious component is detected, the test antenna shall be raised and lowered through the
specified range of heights until a maximum signal level is detected on the measuring receiver.
The equipment shall then be rotated through 360° in the horizontal plane, until the maximum signal level is detected by
the measuring receiver.
The maximum signal level detected by the measuring receiver shall be noted.
The substitution antenna shall be oriented for vertical polarization and calibrated for the frequency of the spurious
component detected.
ETSI
12 Draft ETSI EN 300 718-1 V2.1.0 (2017-09)
The frequency of the calibrated signal generator shall be set to the frequency of the spurious component detected. The
input attenuator setting of the measuring receiver shall be adjusted in order to increase the sensitivity of the measuring
receiver, if necessary.
The test antenna shall be raised and lowered through the specified range of heights to ensure that the maximum signal is
received.
When a test site according to clause B.3 is used, there is no need to vary the height of the antenna.
The input signal to the substitution antenna shall be adjusted until an equal or a known related level to that detected
from the transmitter is obtained on the measuring receiver.
The input signal to the substitution antenna shall be recorded as a power level and corrected for any change of input
attenuator setting of the measuring receiver.
The measurement shall be repeated with the test antenna and the substitution antenna oriented for horizontal
polarization.
The measure of the effective radiated power of the spurious components is the larger of the two power levels recorded
for each spurious component at the input to the substitution antenna, corrected for the gain of the substitution antenna if
necessary.
4.2.4.3.2 Limits
The power of any radiated emission shall not exceed the values given in table 3.
Table 3
State 47 MHz to 74 MHz Other frequencies between
87,5 MHz to 118 MHz 30 to 1 000 MHz
174 MHz to 230 MHz
470 MHz to 862 MHz
Operating 4 nW 250 nW
4.3 Conformance requirements for receivers parameters
4.3.1 Receiver sensitivity
4.3.1.1 Definition
The maximum usable sensitivity of the receiver is the minimum level of the signal (H-field strength) at the nominal
frequency of the receiver which, when applied to the receiver input with normal test modulation (see clause 4.2.1.3),
produces either of the following:
• a (S + N)/N ratio of 6 dB, measured at the terminals of the electroacoustic transducer for beacons with an
acoustic signal indication;
• an unambiguous optical indication of a received beacon signal for beacons with optical signal indication.
4.3.1.2 Method of measurement
For beacons with an acoustic indicator, the terminals of the transducer shall be made accessible for the purposes of the
present document.
A test signal at a carrier frequency equal to the nominal frequency of the receiver, modulated by the normal test
modulation (see clause 4.2) shall be applied in the best coupling position, i.e. when the antenna rod is parallel to the
lines of the magnetic field. An audio frequency load and a measuring instrument for measuring the S/N ratio shall be
connected to the terminals of the electroacoustic transducer.
ETSI
13 Draft ETSI EN 300 718-1 V2.1.0 (2017-09)
The level of the test signal shall be adjusted until a (S + N)/N ratio of 6 dB is obtained. The (S + N)/N ratio is measured
flat over a bandwidth of 20 kHz. The field strength at the receiver shall be measured by a substitution method. Under
these conditions, the level of the test signal at the input is the value of the reference maximum usable sensitivity which
shall be recorded.
For beacons providing optical indication, the level of the test signal shall be adjusted until an unambiguous indication of
the presence of a transmitter is obtained. The field strength at the receiver shall be measured by a substitution method.
Under these conditions, the level of the test signal at the input is the value of the reference maximum usable sensitivity
which shall be recorded.
4.3.1.3 Limits
The appropriate indication shall be achieved for a field strength not higher than 80 nA/m at a frequency of 457 kHz.
4.3.2 Receiver spurious emissions
4.3.2.1 Definition
The level of spurious emissions shall be measured at normal conditions as their effective radiated power or field
strength radiated by the cabinet and the integral antenna.
4.3.2.2 Radiated H-field
4.3.2.2.1 Method of measurement (< 30 MHz)
The field strength shall be measured for frequencies below 30 MHz. The equipment under test shall be measured at a
distance of 10 m on an outdoor test site. The test antenna shall be a calibrated shielded magnetic field antenna. The
equipment under test and test antenna shall be arranged as stated in annex B, clause B.1.
The equipment under test shall be switched on in receive mode. The measuring receiver shall be tuned over the
frequency range 9 kHz to 30 MHz.
At each frequency at which a spurious signal is detected the equipment under test and the test antenna shall be rotated
until maximum field strength is indicated on the measuring receiver. This level shall be noted.
The limits are quoted in dBμA or dBμA/m, so it is necessary to reduce the reading as explained in annex D for
measuring equipment calibrated in dBμV or dBμV/m.
4.3.2.2.2 Limits
Radiated emissions below 30 MHz shall not exceed the generated H-field at 10 m given in table 4.
Table 4
State Frequency 9 kHz ≤ f < 10 MHz Frequency 10 MHz ≤ f < 30 MHz
Receive
6 dBμA/m descending 3 dB/oct -24,5 dBμA/m

A graphical representation is shown in annex C, figure C.1.
4.3.2.3 Effective radiated power
4.3.2.3.1 Method of measurement ( ≥ 30 MHz)
On a test site, selected from annex B, the equipment shall be placed at the specified height on a non-conducting support
and in the position closest to normal use as declared by the manufacturer.
The test antenna shall be oriented for vertical polarization. The output of the test antenna shall be connected to a
measuring receiver.
ETSI
14 Draft ETSI EN 300 718-1 V2.1.0 (2017-09)
The equipment shall be switched on in receive mode, and the measuring receiver shall be tuned over the frequency
range 30 MHz to 1 000 MHz.
At each frequency at which a spurious component is detected, the test antenna shall be raised and lowered through the
specified range of heights until a maximum signal level is detected on the measuring receiver.
The equipment shall then be rotated through 360° in the horizontal plane, until the maximum signal level is detected by
the measuring receiver.
The maximum signal level detected by the measuring receiver shall be noted.
The substitution antenna shall be oriented for vertical polarization and calibrated for the frequency of the spurious
component detected.
The frequency of the calibrated signal generator shall be set to the frequency of the spurious component detected. The
input attenuator setting of the measuring receiver shall be adjusted in order to increase the sensitivity of the measuring
receiver, if necessary.
The test antenna shall be raised and lowered through the specified range of heights to ensure that the maximum signal is
received.
When a test site according to clause B.3 is used, there is no need to vary the height of the antenna.
The input signal to the substitution antenna shall be adjusted until an equal or a known related level to that detected
from the receiver is obtained on the measuring receiver.
The input signal to the substitution antenna shall be recorded as a power level and corrected for any change of input
attenuator setting of the measuring receiver.
The measurement shall be repeated with the test antenna and the substitution antenna oriented for horizontal
polarization.
The measure of the effective radiated power of the spurious components is the larger of the two power levels recorded
for each spurious component at the input to the substitution antenna, corrected for the gain of the substitution antenna if
necessary.
4.3.2.3.2 Limits
The power of any radiated emission shall not exceed the values given in table 5.
Table 5
State 30 MHz to 1 000 MHz
Operating 2 nW
4.3.3 Receiver blocking
Receiver blocking is not applicable for avalanche beacons, due to propagation physics (i.e. magnetic).
The operating range of avalanche beacons is very small, typically 60 m (the minimum range to be compliant to the
standard is about 40 m).
Avalanche beacons use magnetic antennas. They operate in the near field (the transition near field / far field is at
lambda/2pi = 104 m).
In the near field the magnetic field strength varies with 1/r3; therefore avalanche beacons receiver intrinsically need to
handle large signal strength ratios: 60 m / 1 m correspond to a dynamic range of 106 dB at least.
This is tested indirectly with clause 4.4.2 of ETSI EN 300 718-2 [4] "Changes in the received signal".
ETSI
15 Draft ETSI EN 300 718-1 V2.1.0 (2017-09)
5 Test conditions, power sources and ambient
temperatures
5.1 Normal and extreme test conditions
Type testing shall be made under normal test conditions, and also, where stated, under extreme test conditions.
The test conditions and procedures shall be as specified in clauses 5.2 to 5.4.
5.2 External test power source
During type tests, the power source of the equipment shall be replaced by an external test power source capable of
producing normal and extreme test voltages as specified in clauses 5.3.2 and 5.4.2. The internal impedance of the
external test power source shall be low enough for its effect on the test results to be negligible. For the purpose of the
tests, the voltage of the external test power source shall be measured at the input terminals of the equipment.
The non-grounded terminal of the batteries shall be disconnected, but batteries shall be left in place. The external test
power source shall be suitably de-coupled and applied as close to the equipment battery terminals as practicable. The
power leads shall be as short as practicable and properly dressed. For radiated measurements fully charged internal
batteries should be used. The batteries used should be as supplied or recommended by the manufacturer.
During tests the external test power source voltages shall be within a tolerance ±1 % relative to the voltage at the
beginning of each test.
5.3 Normal test conditions
5.3.1 Normal temperature and humidity
The normal temperature and humidity conditions for tests shall be any convenient combination of temperature and
humidity within the following ranges:
• temperature: +15°C to +35°C;
• relative humidity: 20 % to 75 %.
When it is impracticable to carry out tests under these conditions, a note to this effect, stating the ambient temperature
and relative humidity during the tests, shall be added to the test report.
5.3.2 Normal test voltage
The normal test voltage shall be declared by the manufacturer. The values shall be stated in the test report.
5.4 Extreme test conditions
5.4.1 Extreme temperatures
The extreme operating and storage temperatures used for the tests shall be those declared by the manufacturer for the
equipment.
The equipment shall be able to operate correctly in the temperature range from -20 to +45°C and shall be stored without
damage in the temperature range from -25 to +70°C.
ETSI
16 Draft ETSI EN 300 718-1 V2.1.0 (2017-09)
5.4.2 Extreme test voltages
5.4.2.1 General requirement
The extreme test voltages shall be declared by the manufacturer.
5.4.2.2 Procedure for tests at extreme temperatures
Before measurements are made the equipment shall have reached thermal balance in the test chamber.
The equipment shall be switched off during the temperature stabilizing period.
In the case of equipment containing temperature stabilization circuits designed to operate continuously, the temperature
stabilization circuits shall be switched on for 15 minutes after thermal balance has been obtained, and the equipment
shall then meet the specified requirements.
If the thermal balance is not checked by measurements, a temperature stabilizing period of at least one hour, or such
period as may be decided by the accredited test laboratory, shall be allowed. The sequence of measurements shall be
chosen, and the humidity content in the test chamber shall be controlled so that excessive condensation does not occur.
5.5 Measurement uncertainty
The interpretation of the results recorded in a test report for the measurements described in the present document shall
be as follows:
• the measured value related to the corresponding limit will be used to decide whether an equipment meets the
requirements of the present document;
• the value of the measurement uncertainty for the measurement of each parameter shall be included in the test
report;
• the recorded value of the measurement uncertainty shall be, for each measurement, equal to or l
...


HARMONISED EUROPEAN STANDARD
Avalanche Beacons operating at 457 kHz;
Transmitter-receiver systems;
Part 1: Harmonised Standard for access to radio spectrum

2 ETSI EN 300 718-1 V2.1.1 (2018-01)

Reference
REN/ERM-TG28-512-1
Keywords
harmonised standard, radio, testing
ETSI
650 Route des Lucioles
F-06921 Sophia Antipolis Cedex - FRANCE

Tel.: +33 4 92 94 42 00  Fax: +33 4 93 65 47 16

Siret N° 348 623 562 00017 - NAF 742 C
Association à but non lucratif enregistrée à la
Sous-Préfecture de Grasse (06) N° 7803/88

Important notice
The present document can be downloaded from:
http://www.etsi.org/standards-search
The present document may be made available in electronic versions and/or in print. The content of any electronic and/or
print versions of the present document shall not be modified without the prior written authorization of ETSI. In case of any
existing or perceived difference in contents between such versions and/or in print, the only prevailing document is the
print of the Portable Document Format (PDF) version kept on a specific network drive within ETSI Secretariat.
Users of the present document should be aware that the document may be subject to revision or change of status.
Information on the current status of this and other ETSI documents is available at
https://portal.etsi.org/TB/ETSIDeliverableStatus.aspx
If you find errors in the present document, please send your comment to one of the following services:
https://portal.etsi.org/People/CommiteeSupportStaff.aspx
Copyright Notification
No part may be reproduced or utilized in any form or by any means, electronic or mechanical, including photocopying
and microfilm except as authorized by written permission of ETSI.
The content of the PDF version shall not be modified without the written authorization of ETSI.
The copyright and the foregoing restriction extend to reproduction in all media.

© ETSI 2018.
All rights reserved.
TM TM TM
DECT , PLUGTESTS , UMTS and the ETSI logo are trademarks of ETSI registered for the benefit of its Members.
TM
3GPP and LTE™ are trademarks of ETSI registered for the benefit of its Members and
of the 3GPP Organizational Partners.
oneM2M logo is protected for the benefit of its Members.
GSM® and the GSM logo are trademarks registered and owned by the GSM Association.
ETSI
3 ETSI EN 300 718-1 V2.1.1 (2018-01)
Contents
Intellectual Property Rights . 5
Foreword . 5
Modal verbs terminology . 6
1 Scope . 7
2 References . 7
2.1 Normative references . 7
2.2 Informative references . 7
3 Definitions, symbols and abbreviations . 8
3.1 Definitions . 8
3.2 Symbols . 8
3.3 Abbreviations . 9
4 Technical requirements specifications . 9
4.1 Environmental profile . 9
4.2 Conformance requirements for transmitters . 9
4.2.1 Modulation and carrier keying . 9
4.2.1.1 Definition . 9
4.2.1.2 Method of measurement . 9
4.2.1.3 Limits . 9
4.2.2 Frequency error . 10
4.2.2.1 Definition . 10
4.2.2.2 Method of measurement . 10
4.2.2.3 Limits . 10
4.2.3 Output field strength (H-field) . 10
4.2.3.1 Definition . 10
4.2.3.2 Method of measurement . 10
4.2.3.3 Limits . 10
4.2.3.3.1 Minimum transmitted field . 10
4.2.3.3.2 Maximum transmitted field . 10
4.2.4 Transmitter spurious emis sions . 11
4.2.4.1 Definition . 11
4.2.4.2 Radiated H-field . 11
4.2.4.2.1 Method of measurement (< 30 MHz) . 11
4.2.4.2.2 Limits . 11
4.2.4.3 Effective radiated power . 11
4.2.4.3.1 Method of measurement ( ≥ 30 MHz) . 11
4.2.4.3.2 Limits . 12
4.3 Conformance requirements for receivers parameters . 12
4.3.1 Receiver sensitivity . 12
4.3.1.1 Definition . 12
4.3.1.2 Method of measurement . 12
4.3.1.3 Limits . 13
4.3.2 Receiver spurious emissions . 13
4.3.2.1 Definition . 13
4.3.2.2 Radiated H-field . 13
4.3.2.2.1 Method of measurement (< 30 MHz) . 13
4.3.2.2.2 Limits . 13
4.3.2.3 Effective radiated power . 13
4.3.2.3.1 Method of measurement ( ≥ 30 MHz) . 13
4.3.2.3.2 Limits . 14
4.3.3 Receiver blocking . 14
5 Test conditions, power sources and ambient temperatures . 15
5.1 Normal and extreme test conditions . 15
5.2 External test power source. 15
5.3 Normal test conditions . 15
ETSI
4 ETSI EN 300 718-1 V2.1.1 (2018-01)
5.3.1 Normal temperature and humidity . 15
5.3.2 Normal test voltage . 15
5.4 Extreme test conditions . 15
5.4.1 Extreme temperatures . 15
5.4.2 Extreme test voltages . 16
5.4.2.1 General requirement . 16
5.4.2.2 Procedure for tests at extreme temperatures . 16
5.5 Measurement uncertainty . 16
Annex A (informative): Relationship between the present document and the essential
requirements of Directive 2014/53/EU . 17
Annex B (normative): Test sites and general arrangements for measurements involving the
use of radiated fields . 18
B.1 General . 18
B.1.1 Normal test signals . 18
B.1.2 Test fixture . 18
B.1.3 Measuring receiver . 18
B.2 Outdoor test site . 19
B.2.1 General requirements . 19
B.2.2 Standard position . 19
B.3 Test antenna . 20
B.3.1 Below 30 MHz . 20
B.3.2 Above 30 MHz . 20
B.4 Substitution antenna . 20
B.4.1 General . 20
B.4.2 Optional additional indoor site . 21
B.5 Guidance on the use of radiation test sites . 22
B.5.1 General . 22
B.5.2 Measuring distance . 22
B.5.3 Test antenna . 22
B.5.4 Substitution antenna . 22
B.5.5 Artificial antenna . 22
B.5.6 Auxiliary cables . 22
B.6 Further optional alternative indoor test site using an anechoic chamber . 23
B.6.1 General . 23
B.6.2 Example of the construction of a shielded anechoic chamber . 23
B.6.3 Influence of parasitic reflections in anechoic chambers . 23
B.6.4 Calibration of the shielded RF anechoic chamber . 24
Annex C (normative): Spurious limits, radiated H-field at 10 m distances . 26
Annex D (informative): E-fields in the near field at low frequencies . 27
Annex E (informative): Change history . 30
History . 31

ETSI
5 ETSI EN 300 718-1 V2.1.1 (2018-01)
Intellectual Property Rights
Essential patents
IPRs essential or potentially essential to the present document may have been declared to ETSI. The information
pertaining to these essential IPRs, if any, is publicly available for ETSI members and non-members, and can be found
in ETSI SR 000 314: "Intellectual Property Rights (IPRs); Essential, or potentially Essential, IPRs notified to ETSI in
respect of ETSI standards", which is available from the ETSI Secretariat. Latest updates are available on the ETSI Web
server (https://ipr.etsi.org/).
Pursuant to the ETSI IPR Policy, no investigation, including IPR searches, has been carried out by ETSI. No guarantee
can be given as to the existence of other IPRs not referenced in ETSI SR 000 314 (or the updates on the ETSI Web
server) which are, or may be, or may become, essential to the present document.
Trademarks
The present document may include trademarks and/or tradenames which are asserted and/or registered by their owners.
ETSI claims no ownership of these except for any which are indicated as being the property of ETSI, and conveys no
right to use or reproduce any trademark and/or tradename. Mention of those trademarks in the present document does
not constitute an endorsement by ETSI of products, services or organizations associated with those trademarks.
Foreword
This Harmonised European Standard (EN) has been produced by ETSI Technical Committee Electromagnetic
compatibility and Radio spectrum Matters (ERM).
The present document has been prepared under the Commission's standardisation request C(2015) 5376 final [i.2] to
provide one voluntary means of conforming to the essential requirements of Directive 2014/53/EU on the harmonisation
of the laws of the Member States relating to the making available on the market of radio equipment and repealing
Directive 1999/5/EC [i.1].
Once the present document is cited in the Official Journal of the European Union under that Directive, compliance with
the normative clauses of the present document given in table A.1 confers, within the limits of the scope of the present
document, a presumption of conformity with the corresponding essential requirements of that Directive and associated
EFTA regulations.
The present document is part 1 of a multi-part deliverable covering avalanche beacons operating at 457 kHz transmitter-
receiver systems, as identified below:
Part 1: "Harmonised Standard for access to radio spectrum";
Part 2: "Harmonised Standard for features for emergency services".

National transposition dates
Date of adoption of this EN: 18 December 2017
Date of latest announcement of this EN (doa): 31 March 2018
Date of latest publication of new National Standard
or endorsement of this EN (dop/e): 30 September 2018
Date of withdrawal of any conflicting National Standard (dow): 30 September 2019

ETSI
6 ETSI EN 300 718-1 V2.1.1 (2018-01)
Modal verbs terminology
In the present document "shall", "shall not", "should", "should not", "may", "need not", "will", "will not", "can" and
"cannot" are to be interpreted as described in clause 3.2 of the ETSI Drafting Rules (Verbal forms for the expression of
provisions).
"must" and "must not" are NOT allowed in ETSI deliverables except when used in direct citation.

ETSI
7 ETSI EN 300 718-1 V2.1.1 (2018-01)
1 Scope
The present document specifies technical characteristics and methods of measurements for avalanche beacons operating
at 457 kHz transmitter-receiver systems.
NOTE: The relationship between the present document and essential requirements of article 3.2 of Directive
2014/53/EU [i.1] is given in annex A.
2 References
2.1 Normative references
References are specific, identified by date of publication and/or edition number or version number. Only the cited
version applies.
Referenced documents which are not found to be publicly available in the expected location might be found at
https://docbox.etsi.org/Reference/.
NOTE: While any hyperlinks included in this clause were valid at the time of publication, ETSI cannot guarantee
their long term validity.
The following referenced documents are necessary for the application of the present document.
[1] CISPR 16-1-1 (2015): "Specification for radio disturbance and immunity measuring apparatus and
methods - Part 1-1: Radio disturbance and immunity measuring apparatus - Measuring apparatus".
[2] CISPR 16-1-4 (2010): "Part 1-4: Radio disturbance and immunity measuring apparatus - Antennas
and test sites for radiated disturbance measurements".
[3] CISPR 16-1-5 (2014): "Specification for radio disturbance and immunity measuring apparatus and
methods; Part 1-5: Radio disturbance and immunity measuring apparatus - Antenna calibration
sites and reference test sites for 5 MHz to 18 GHz".
[4] ETSI EN 300 718-2 (V2.1.1) (01-2018): "Avalanche Beacons operating at 457 kHz; Transmitter-
receiver systems; Part 2: Harmonised Standard for features for emergency services".
2.2 Informative references
References are either specific (identified by date of publication and/or edition number or version number) or
non-specific. For specific references, only the cited version applies. For non-specific references, the latest version of the
referenced document (including any amendments) applies.
NOTE: While any hyperlinks included in this clause were valid at the time of publication, ETSI cannot guarantee
their long term validity.
The following referenced documents are not necessary for the application of the present document but they assist the
user with regard to a particular subject area.
[i.1] Directive 2014/53/EU of the European Parliament and of the Council of 16 April 2014 on the
harmonisation of the laws of the Member States relating to the making available on the market of
radio equipment and repealing Directive 1999/5/EC.
[i.2] Commission Implementing Decision C(2015) 5376 final of 4.8.2015 on a standardisation request
to the European Committee for Electrotechnical Standardisation and to the European
Telecommunications Standards Institute as regards radio equipment in support of Directive
2014/53/EU of the European Parliament and of the Council.
[i.3] ITU Radio Regulations (2012), Appendix 1 (REV.WRC-12): "Classification of emissions and
necessary bandwidths".
ETSI
8 ETSI EN 300 718-1 V2.1.1 (2018-01)
[i.4] ETSI TR 100 028 (all parts): "Electromagnetic compatibility and Radio spectrum Matters (ERM);
Uncertainties in the measurement of mobile radio equipment characteristics".
3 Definitions, symbols and abbreviations
3.1 Definitions
For the purposes of the present document, the following terms and definitions apply:
avalanche beacons: portable radio systems used for locating avalanche victims, for the purpose of direct rescue
NOTE: I.e. for rescue by comrades not buried by the avalanche.
artificial antenna: tuned reduced-radiating dummy load equal to the nominal impedance specified by the manufacturer
conducted measurements: measurements which are made using a direct connection to the equipment under test
E-field: electric component of the field measured as voltage per unit length
environmental profile: range of environmental conditions under which equipment within the scope of the present
document is required to comply with the provisions of the present document
H-field: magnetic component of the field measured as current per unit length
H-field test antenna: electrically screened loop or equivalent antenna, with which the magnetic component of the field
can be measured
integral antenna: antenna designed as an indispensable part of the equipment, with or without the use of an antenna
connector
radiated measurements: measurements which involve the absolute measurement of a radiated field
(S + N)/N: ratio, expressed in Decibels, between the sum of the wanted signal plus the noise floor and the noise floor
3.2 Symbols
For the purposes of the present document, the following abbreviations apply:
A1A Class of emission
NOTE: See ITU Radio Regulations [i.3].
E Electrical field strength
Eo Reference electrical field strength
NOTE: See annex B.
f Frequency
H Magnetic field strength
Ho Reference magnetic field strength
NOTE: See annex B.
N Newton
P Power
R Distance
Ro Reference distance
NOTE: See annex B.
t Time
Z Wave impedance
ETSI
9 ETSI EN 300 718-1 V2.1.1 (2018-01)
l Wavelength
NOTE: See annex B.
3.3 Abbreviations
For the purposes of the present document, the following abbreviations apply:
RF Radio Frequency
4 Technical requirements specifications
4.1 Environmental profile
The technical requirements of the present document apply under the environmental profile for operation of the
equipment, which shall be declared by the manufacturer. The equipment shall comply with all the technical
requirements of the present document which are identified as applicable in annex A at all times when operating within
the boundary limits of the declared operational environmental profile.
4.2 Conformance requirements for transmitters
4.2.1 Modulation and carrier keying
4.2.1.1 Definition
The modulation is the method for generating the RF carrier. The carrier keying defines the on and off times for a
non-continuous carrier.
4.2.1.2 Method of measurement
The carrier keying shall be measured by means of an oscilloscope connected to a suitable coil antenna. The
measurements shall be done under normal as well as under extreme test conditions.
4.2.1.3 Limits
The modulation shall be of type A1A, i.e. double sideband amplitude modulation with no modulating auxiliary carrier,
as used for telegraphy.
The carrier keying shall be as shown in figure 1:
• on time: 70 ms minimum;
• off time: 400 ms minimum;
• period: 1 000 ms ± 300 ms (on time plus off time).
ETSI
10 ETSI EN 300 718-1 V2.1.1 (2018-01)

1 000 ± 300 ms
status
≥ 70 ms
≥ 400 ms
on
time
off
Figure 1
4.2.2 Frequency error
4.2.2.1 Definition
The frequency error of the transmitter system is the difference between the measured carrier frequency and the nominal
carrier frequency.
4.2.2.2 Method of measurement
The carrier frequency shall be measured by means of a test fixture (see annex B, clause B.1.2). The measurements shall
be done under normal as well as under extreme test conditions as defined in clause 5.
4.2.2.3 Limits
The frequency error shall not exceed ±80 Hz at 457 kHz.
4.2.3 Output field strength (H-field)
4.2.3.1 Definition
The H-field is measured in the direction of maximum field strength under specified conditions of measurement.
4.2.3.2 Method of measurement
The H-field produced by the equipment shall be measured on the axis of the transmitting antenna at distances of 10 m
on an outdoor test site (see annex B).
4.2.3.3 Limits
4.2.3.3.1 Minimum transmitted field
The minimum transmitted field strength at 457 kHz shall not be lower than -6 dBμA/m (0,5 μA/m) at a distance of
10 m.
4.2.3.3.2 Maximum transmitted field
The maximum transmitted field strength at 457 kHz shall not exceed 7 dBμA/m (2,23 μA/m) at a distance of 10 m.
ETSI
11 ETSI EN 300 718-1 V2.1.1 (2018-01)
4.2.4 Transmitter spurious emissions
4.2.4.1 Definition
Spurious emissions are emissions at frequencies other than those of the carrier and sidebands associated with normal
modulation. The level of spurious emissions shall be measured at normal conditions as their effective radiated power or
field strength radiated by the cabinet and the integral antenna.
4.2.4.2 Radiated H-field
4.2.4.2.1 Method of measurement (< 30 MHz)
The field strength shall be measured for frequencies below 30 MHz. The equipment under test shall be measured at a
distance of 10 m on an outdoor test site. The test antenna shall be a calibrated shielded magnetic field antenna. The
equipment under test and test antenna shall be arranged as stated in annex B, clause B.2.
The equipment under test shall be switched on in transmit mode (see clause 4.2). The measuring receiver shall be tuned
over the frequency range 9 kHz to 30 MHz, except for the frequency band ±20 kHz from the frequency on which the
transmitter is intended to operate.
At each frequency at which a spurious signal is detected the equipment under test and the test antenna shall be rotated
until maximum field strength is indicated on the measuring receiver. This level shall be noted.
The limits are quoted in dBμA or dBμA/m, so it is necessary to reduce the reading as explained in annex D for
measuring equipment calibrated in dBμV or dBμV/m.
4.2.4.2.2 Limits
Radiated emissions below 30 MHz shall not exceed the generated H-field at 10 m given in table 2.
Table 2
State Frequency 9 kHz ≤ f < 10 MHz Frequency 10 MHz ≤ f < 30 MHz
Transmit
27 dBμA/m descending 3 dB/oct -3,5 dBμA/m

A graphical representation is shown in annex C, figure C.1.
4.2.4.3 Effective radiated power
4.2.4.3.1 Method of measurement ( ≥ 30 MHz)
On a test site, selected from annex B, the equipment shall be placed at the specified height on a non-conducting support
and in the position closest to normal use as declared by the manufacturer.
The test antenna shall be oriented for vertical polarization. The output of the test antenna shall be connected to a
measuring receiver.
The equipment shall be switched on in transmit mode, and the measuring receiver shall be tuned over the frequency
range 30 MHz to 1 000 MHz.
At each frequency at which a spurious component is detected, the test antenna shall be raised and lowered through the
specified range of heights until a maximum signal level is detected on the measuring receiver.
The equipment shall then be rotated through 360° in the horizontal plane, until the maximum signal level is detected by
the measuring receiver.
The maximum signal level detected by the measuring receiver shall be noted.
The substitution antenna shall be oriented for vertical polarization and calibrated for the frequency of the spurious
component detected.
ETSI
12 ETSI EN 300 718-1 V2.1.1 (2018-01)
The frequency of the calibrated signal generator shall be set to the frequency of the spurious component detected. The
input attenuator setting of the measuring receiver shall be adjusted in order to increase the sensitivity of the measuring
receiver, if necessary.
The test antenna shall be raised and lowered through the specified range of heights to ensure that the maximum signal is
received.
When a test site according to clause B.3 is used, there is no need to vary the height of the antenna.
The input signal to the substitution antenna shall be adjusted until an equal or a known related level to that detected
from the transmitter is obtained on the measuring receiver.
The input signal to the substitution antenna shall be recorded as a power level and corrected for any change of input
attenuator setting of the measuring receiver.
The measurement shall be repeated with the test antenna and the substitution antenna oriented for horizontal
polarization.
The measure of the effective radiated power of the spurious components is the larger of the two power levels recorded
for each spurious component at the input to the substitution antenna, corrected for the gain of the substitution antenna if
necessary.
4.2.4.3.2 Limits
The power of any radiated emission shall not exceed the values given in table 3.
Table 3
State 47 MHz to 74 MHz Other frequencies between
87,5 MHz to 118 MHz 30 to 1 000 MHz
174 MHz to 230 MHz
470 MHz to 862 MHz
Operating 4 nW 250 nW
4.3 Conformance requirements for receivers parameters
4.3.1 Receiver sensitivity
4.3.1.1 Definition
The maximum usable sensitivity of the receiver is the minimum level of the signal (H-field strength) at the nominal
frequency of the receiver which, when applied to the receiver input with normal test modulation (see clause 4.2.1.3),
produces either of the following:
• a (S + N)/N ratio of 6 dB, measured at the terminals of the electroacoustic transducer for beacons with an
acoustic signal indication;
• an unambiguous optical indication of a received beacon signal for beacons with optical signal indication.
4.3.1.2 Method of measurement
For beacons with an acoustic indicator, the terminals of the transducer shall be made accessible for the purposes of the
present document.
A test signal at a carrier frequency equal to the nominal frequency of the receiver, modulated by the normal test
modulation (see clause 4.2) shall be applied in the best coupling position, i.e. when the antenna rod is parallel to the
lines of the magnetic field. An audio frequency load and a measuring instrument for measuring the S/N ratio shall be
connected to the terminals of the electroacoustic transducer.
ETSI
13 ETSI EN 300 718-1 V2.1.1 (2018-01)
The level of the test signal shall be adjusted until a (S + N)/N ratio of 6 dB is obtained. The (S + N)/N ratio is measured
flat over a bandwidth of 20 kHz. The field strength at the receiver shall be measured by a substitution method. Under
these conditions, the level of the test signal at the input is the value of the reference maximum usable sensitivity which
shall be recorded.
For beacons providing optical indication, the level of the test signal shall be adjusted until an unambiguous indication of
the presence of a transmitter is obtained. The field strength at the receiver shall be measured by a substitution method.
Under these conditions, the level of the test signal at the input is the value of the reference maximum usable sensitivity
which shall be recorded.
4.3.1.3 Limits
The appropriate indication shall be achieved for a field strength not higher than 80 nA/m at a frequency of 457 kHz.
4.3.2 Receiver spurious emissions
4.3.2.1 Definition
The level of spurious emissions shall be measured at normal conditions as their effective radiated power or field
strength radiated by the cabinet and the integral antenna.
4.3.2.2 Radiated H-field
4.3.2.2.1 Method of measurement (< 30 MHz)
The field strength shall be measured for frequencies below 30 MHz. The equipment under test shall be measured at a
distance of 10 m on an outdoor test site. The test antenna shall be a calibrated shielded magnetic field antenna. The
equipment under test and test antenna shall be arranged as stated in annex B, clause B.1.
The equipment under test shall be switched on in receive mode. The measuring receiver shall be tuned over the
frequency range 9 kHz to 30 MHz.
At each frequency at which a spurious signal is detected the equipment under test and the test antenna shall be rotated
until maximum field strength is indicated on the measuring receiver. This level shall be noted.
The limits are quoted in dBμA or dBμA/m, so it is necessary to reduce the reading as explained in annex D for
measuring equipment calibrated in dBμV or dBμV/m.
4.3.2.2.2 Limits
Radiated emissions below 30 MHz shall not exceed the generated H-field at 10 m given in table 4.
Table 4
State Frequency 9 kHz ≤ f < 10 MHz Frequency 10 MHz ≤ f < 30 MHz
Receive
6 dBμA/m descending 3 dB/oct -24,5 dBμA/m

A graphical representation is shown in annex C, figure C.1.
4.3.2.3 Effective radiated power
4.3.2.3.1 Method of measurement ( ≥ 30 MHz)
On a test site, selected from annex B, the equipment shall be placed at the specified height on a non-conducting support
and in the position closest to normal use as declared by the manufacturer.
The test antenna shall be oriented for vertical polarization. The output of the test antenna shall be connected to a
measuring receiver.
ETSI
14 ETSI EN 300 718-1 V2.1.1 (2018-01)
The equipment shall be switched on in receive mode, and the measuring receiver shall be tuned over the frequency
range 30 MHz to 1 000 MHz.
At each frequency at which a spurious component is detected, the test antenna shall be raised and lowered through the
specified range of heights until a maximum signal level is detected on the measuring receiver.
The equipment shall then be rotated through 360° in the horizontal plane, until the maximum signal level is detected by
the measuring receiver.
The maximum signal level detected by the measuring receiver shall be noted.
The substitution antenna shall be oriented for vertical polarization and calibrated for the frequency of the spurious
component detected.
The frequency of the calibrated signal generator shall be set to the frequency of the spurious component detected. The
input attenuator setting of the measuring receiver shall be adjusted in order to increase the sensitivity of the measuring
receiver, if necessary.
The test antenna shall be raised and lowered through the specified range of heights to ensure that the maximum signal is
received.
When a test site according to clause B.3 is used, there is no need to vary the height of the antenna.
The input signal to the substitution antenna shall be adjusted until an equal or a known related level to that detected
from the receiver is obtained on the measuring receiver.
The input signal to the substitution antenna shall be recorded as a power level and corrected for any change of input
attenuator setting of the measuring receiver.
The measurement shall be repeated with the test antenna and the substitution antenna oriented for horizontal
polarization.
The measure of the effective radiated power of the spurious components is the larger of the two power levels recorded
for each spurious component at the input to the substitution antenna, corrected for the gain of the substitution antenna if
necessary.
4.3.2.3.2 Limits
The power of any radiated emission shall not exceed the values given in table 5.
Table 5
State 30 MHz to 1 000 MHz
Operating 2 nW
4.3.3 Receiver blocking
Receiver blocking is not applicable for avalanche beacons, due to propagation physics (i.e. magnetic).
The operating range of avalanche beacons is very small, typically 60 m (the minimum range to be compliant to the
standard is about 40 m).
Avalanche beacons use magnetic antennas. They operate in the near field (the transition near field / far field is at
lambda/2pi = 104 m).
In the near field the magnetic field strength varies with 1/r3; therefore avalanche beacons receiver intrinsically need to
handle large signal strength ratios: 60 m / 1 m correspond to a dynamic range of 106 dB at least.
This is tested indirectly with clause 4.4.2 of ETSI EN 300 718-2 [4] "Changes in the received signal".
ETSI
15 ETSI EN 300 718-1 V2.1.1 (2018-01)
5 Test conditions, power sources and ambient
temperatures
5.1 Normal and extreme test conditions
Type testing shall be made under normal test conditions, and also, where stated, under extreme test conditions.
The test conditions and procedures shall be as specified in clauses 5.2 to 5.4.
5.2 External test power source
During type tests, the power source of the equipment shall be replaced by an external test power source capable of
producing normal and extreme test voltages as specified in clauses 5.3.2 and 5.4.2. The internal impedance of the
external test power source shall be low enough for its effect on the test results to be negligible. For the purpose of the
tests, the voltage of the external test power source shall be measured at the input terminals of the equipment.
The non-grounded terminal of the batteries shall be disconnected, but batteries shall be left in place. The external test
power source shall be suitably de-coupled and applied as close to the equipment battery terminals as practicable. The
power leads shall be as short as practicable and properly dressed. For radiated measurements fully charged internal
batteries should be used. The batteries used should be as supplied or recommended by the manufacturer.
During tests the external test power source voltages shall be within a tolerance ±1 % relative to the voltage at the
beginning of each test.
5.3 Normal test conditions
5.3.1 Normal temperature and humidity
The normal temperature and humidity conditions for tests shall be any convenient combination of temperature and
humidity within the following ranges:
• temperature: +15°C to +35°C;
• relative humidity: 20 % to 75 %.
When it is impracticable to carry out tests under these conditions, a note to this effect, stating the ambient temperature
and relative humidity during the tests, shall be added to the test report.
5.3.2 Normal test voltage
The normal test voltage shall be declared by the manufacturer. The values shall be stated in the test report.
5.4 Extreme test conditions
5.4.1 Extreme temperatures
The extreme operating and storage temperatures used for the tests shall be those declared by the manufacturer for the
equipment.
The equipment shall be able to operate correctly in the temperature range from -20 to +45°C and shall be stored without
damage in the temperature range from -25 to +70°C.
ETSI
16 ETSI EN 300 718-1 V2.1.1 (2018-01)
5.4.2 Extreme test voltages
5.4.2.1 General requirement
The extreme test voltages shall be declared by the manufacturer.
5.4.2.2 Procedure for tests at extreme temperatures
Before measurements are made the equipment shall have reached thermal balance in the test chamber.
The equipment shall be switched off during the temperature stabilizing period.
In the case of equipment containing temperature stabilization circuits designed to operate continuously, the temperature
stabilization circuits shall be switched on for 15 minutes after thermal balance has been obtained, and the equipment
shall then meet the specified requirements.
If the thermal balance is not checked by measurements, a temperature stabilizing period of at least one hour, or such
period as may be decided by the accredited test laboratory, shall be allowed. The sequence of measurements shall be
chosen, and the humidity content in the test chamber shall be controlled so that excessive condensation does not occur.
5.5 Measurement uncertainty
The interpretation of the results recorded in a test report for the measurements described in the present document shall
be as follows:
• the measured value related to the corresponding limit will be used to decide whether an equipment meets the
requirements of the present document;
• the value of the measurement uncertainty for the measurement of each parameter shall be included in the test
report;
• the recorded value of the measurement uncertainty shall be, for each measurement, equal to or less than the
figures in table 6.
Table 6
Parameter Uncertainty
-6
RF frequency
±1 x 10
Radiated emission of transmitter, valid up to 1 GHz ±2 dB
(Substituti
...


2003-01.Slovenski inštitut za standardizacijo. Razmnoževanje celote ali delov tega standarda ni dovoljeno.Avalanche Beacons operating at 457 kHz - Transmitter-receiver systems - Part 1: Harmonised Standard for access to radio spectrum33.060.20Sprejemna in oddajna opremaReceiving and transmitting equipment13.200NDWDVWURIAccident and disaster controlICS:Ta slovenski standard je istoveten z:ETSI EN 300 718-1 V2.1.1 (2018-01)SIST EN 300 718-1 V2.1.1:2018en01-marec-2018SIST EN 300 718-1 V2.1.1:2018SLOVENSKI
STANDARD
wwwwwETSI EN 300 718-1 V2.1.1 (2018-01) Avalanche Beacons operating at 457 kHz; Transmitter-receiver systems; Part 1: Harmonised Standard for access to radio spectrum
HARMONISED EUROPEAN STANDARD SIST EN 300 718-1 V2.1.1:2018

ETSI ETSI EN 300 718-1 V2.1.1 (2018-01) 2 wwwoeferencewREN/ERM-TG28-512-1 heywordswharmonised standard, radio, testing ETSI 650 Route des Lucioles F-06921 Sophia Antipolis Cedex - FRANCEw Tel.: +33 4 92 94 42 00
Fax: +33 4 93 65 47 16
Siret N° 348 623 562 00017 - NAF 742 C Association à but non lucratif enregistrée à la Sous-Préfecture de Grasse (06) N° 7803/88
Important notice The present document can be downloaded from: http://www.etsi.org/standards-search The present document may be made available in electronic versions and/or in print. The content of any electronic and/or print versions of the present document shall not be modified without the prior written authorization of ETSI. In case of any existing or perceived difference in contents between such versions and/or in print, the only prevailing document is the print of the Portable Document Format (PDF) version kept on a specific network drive within ETSI Secretariat. Users of the present document should be aware that the document may be subject to revision or change of status. Information on the current status of this and other ETSI documents is available at https://portal.etsi.org/TB/ETSIDeliverableStatus.aspx If you find errors in the present document, please send your comment to one of the following services: https://portal.etsi.org/People/CommiteeSupportStaff.aspx Copyright Notification No part may be reproduced or utilized in any form or by any means, electronic or mechanical, including photocopying and microfilm except as authorized by written permission of ETSI. The content of the PDF version shall not be modified without the written authorization of ETSI. The copyright and the foregoing restriction extend to reproduction in all media.
© ETSI 2018. All rights reserved.
DECTTM, PLUGTESTSTM, UMTSTM and the ETSI logo are trademarks of ETSI registered for the benefit of its Members. 3GPPTM and LTE™ are trademarks of ETSI registered for the benefit of its Members and of the 3GPP Organizational Partners. oneM2M logo is protected for the benefit of its Members. GSM® and the GSM logo are trademarks registered and owned by the GSM Association. SIST EN 300 718-1 V2.1.1:2018

ETSI ETSI EN 300 718-1 V2.1.1 (2018-01) 3 Contents fntellectualwmropertywoightswhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwo corewordwhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwo jodalwverbswterminologywhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwp kwpcopewhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwq lwoeferenceswhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwq lhkwkormativewreferenceswhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwq lhlwfnformativewreferenceswhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwq mwaefinitionsfwsymbolswandwabbreviationswhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwr mhkwaefinitionswhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwr mhlwpymbolswhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwr mhmwAbbreviationswhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhws 4wqechnicalwrequirementswspecificationswhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhws 4hkwbnvironmentalwprofilewhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhws 4hlwConformancewrequirementswforwtransmitterswhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhws 4hlhkwjodulationwandwcarrierwkeyingwhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhws 4hlhkhkwaefinitionwhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhws 4hlhkhlwjethodwofwmeasurementwhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhws 4hlhkhmwiimitswhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhws 4hlhlwcrequencywerrorwhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwkj 4hlhlhkwaefinitionwhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwkj 4hlhlhlwjethodwofwmeasurementwhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwkj 4hlhlhmwiimitswhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwkj 4hlhmwlutputwfieldwstrengthwbegfieldcwhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwkj 4hlhmhkwaefinitionwhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwkj 4hlhmhlwjethodwofwmeasurementwhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwkj 4hlhmhmwiimitswhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwkj 4hlhmhmhkwjinimumwtransmittedwfieldwhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwkj 4hlhmhmhlwjaximumwtransmittedwfieldwhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwkj 4hlh4wqransmitterwspuriouswemissionswhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwkk 4hlh4hkwaefinitionwhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwkk 4hlh4hlwoadiatedwegfieldwhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwkk 4hlh4hlhkwjethodwofwmeasurementwb
ETSI ETSI EN 300 718-1 V2.1.1 (2018-01) 4 ohmhkwkormalwtemperaturewandwhumiditywhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwko ohmhlwkormalwtestwvoltagewhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwko oh4wbxtremewtestwconditionswhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwko oh4hkwbxtremewtemperatureswhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwko oh4hlwbxtremewtestwvoltageswhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwkp oh4hlhkwdeneralwrequirementwhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwkp oh4hlhlwmrocedurewforwtestswatwextremewtemperatureswhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwkp ohowjeasurementwuncertaintywhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwkp Annex A (informative): Relationship between the present document and the essential requirements of Directive 2014/53/EU . 17 Annex B (normative): Test sites and general arrangements for measurements involving the use of radiated fields . 18 Bhkwdeneralwhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwkr Bhkhkwkormalwtestwsignalswhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwkr Bhkhlwqestwfixturewhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwkr Bhkhmwjeasuringwreceiverwhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwkr Bhlwlutdoorwtestwsitewhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwks Bhlhkwdeneralwrequirementswhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwks Bhlhlwptandardwpositionwhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwks Bhmwqestwantennawhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwlj BhmhkwBelowwmjwjezwhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwlj BhmhlwAbovewmjwjezwhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwlj Bh4wpubstitutionwantennawhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwlj Bh4hkwdeneralwhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwlj Bh4hlwlptionalwadditionalwindoorwsitewhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwlk Bhowduidancewonwthewusewofwradiationwtestwsiteswhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwll Bhohkwdeneralwhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwll Bhohlwjeasuringwdistancewhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwll Bhohmwqestwantennawhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwll Bhoh4wpubstitutionwantennawhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwll BhohowArtificialwantennawhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwll BhohpwAuxiliarywcableswhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwll Bhpwcurtherwoptionalwalternativewindoorwtestwsitewusingwanwanechoicwchamberwhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwlm Bhphkwdeneralwhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwlm Bhphlwbxamplewofwthewconstructionwofwawshieldedwanechoicwchamberwhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwlm Bhphmwfnfluencewofwparasiticwreflectionswinwanechoicwchamberswhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwlm Bhph4wCalibrationwofwthewshieldedwocwanechoicwchamberwhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwl4 Annex C (normative): Spurious limits, radiated H-field at 10 m distances . 26 Annex D (informative): E-fields in the near field at low frequencies . 27 Annex E (informative): Change history . 30 eistorywhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhwmk ww SIST EN 300 718-1 V2.1.1:2018

ETSI ETSI EN 300 718-1 V2.1.1 (2018-01) 5 Intellectual Property Rights Essential patents fmoswessentialworwpotentiallywessentialwtowthewpresentwdocumentwmaywhavewbeenwdeclaredwtowbqpfhwqhewinformationwpertainingwtowthesewessentialwfmosfwifwanyfwiswpubliclywavailablewforwETSI members and non-membersfwandwcanwbewfoundwinwbqpfwpowjjjwmk4tw"Intellectual Property Rights (IPRs); Essential, or potentially Essential, IPRs notified to ETSI in respect of ETSI standards"fwwhichwiswavailablewfromwthewbqpfwpecretariathwiatestwupdateswarewavailablewonwthewbqpfwtebwserverwbhttpstiiiprhetsihorgichwmursuantwtowthewbqpfwfmowmolicyfwnowinvestigationfwincludingwfmowsearchesfwhaswbeenwcarriedwoutwbywbqpfhwkowguaranteewcanwbewgivenwaswtowthewexistencewofwotherwfmoswnotwreferencedwinwbqpfwpowjjjwmk4wborwthewupdateswonwthewbqpfwtebwservercwwhichwarefworwmaywbefworwmaywbecomefwessentialwtowthewpresentwdocumenthwTrademarks qhewpresentwdocumentwmaywincludewtrademarkswandiorwtradenameswwhichwarewassertedwandiorwregisteredwbywtheirwownershwbqpfwclaimswnowownershipwofwthesewexceptwforwanywwhichwarewindicatedwaswbeingwthewpropertywofwbqpffwandwconveyswnowrightwtowuseworwreproducewanywtrademarkwandiorwtradenamehwjentionwofwthosewtrademarkswinwthewpresentwdocumentwdoeswnotwconstitutewanwendorsementwbywbqpfwofwproductsfwservicesworworganizationswassociatedwwithwthosewtrademarkshwForeword qhiswearmonisedwburopeanwptandardwbbkcwhaswbeenwproducedwbywbqpfwqechnicalwCommitteewblectromagneticwcompatibilitywandwoadiowspectrumwjatterswbbojchwqhewpresentwdocumentwhaswbeenwpreparedwunderwthewCommissionaswstandardisationwrequestwCbljkocwomqpwfinalwxihlzwtowprovidewonewvoluntarywmeanswofwconformingwtowthewessentialwrequirementswofwairectivewljk4iomibrwonwthewharmonisationwofwthewlawswofwthewjemberwptateswrelatingwtowthewmakingwavailablewonwthewmarketwofwradiowequipmentwandwrepealingwairectivewksssioibCwxihkzhwlncewthewpresentwdocumentwiswcitedwinwthewlfficialwgournalwofwthewburopeanwrnionwunderwthatwairectivefwcompliancewwithwthewnormativewclauseswofwthewpresentwdocumentwgivenwinwtablewAhkwconfersfwwithinwthewlimitswofwthewscopewofwthewpresentwdocumentfwawpresumptionwofwconformitywwithwthewcorrespondingwessentialwrequirementswofwthatwairectivewandwassociatedwbcqAwregulationshwqhewpresentwdocumentwiswpartwkwofwawmultigpartwdeliverablewcoveringwavalanchewbeaconswoperatingwatw4oqwkezwtransmittergreceiverwsystemsfwaswidentifiedwbelowtwPart 1: "Harmonised Standard for access to radio spectrum"; martwltw"earmonisedwptandardwforwfeatureswforwemergencywservices"hwwNational transposition dates aatewofwadoptionwofwthiswbktwkrwaecemberwljkqwaatewofwlatestwannouncementwofwthiswbkwbdoactwmkwjarchwljkrwaatewofwlatestwpublicationwofwnewwkationalwptandardworwendorsementwofwthiswbkwbdopiectwwmjwpeptemberwljkrwaatewofwwithdrawalwofwanywconflictingwkationalwptandardwbdowctwmjwpeptemberwljkswwSIST EN 300 718-1 V2.1.1:2018

ETSI ETSI EN 300 718-1 V2.1.1 (2018-01) 6 Modal verbs terminology fnwthewpresentwdocumentw"shall"fw"shall not"fw"should"fw"should not"fw"may"fw"need not"fw"will"fw"will not"fw"can"wandw"cannot"warewtowbewinterpretedwaswdescribedwinwclausewmhlwofwthewbqpfwaraftingwouleswbserbalwformswforwthewexpressionwofwprovisionschw"must"wandw"must not"warewNOTwallowedwinwbqpfwdeliverableswexceptwwhenwusedwinwdirectwcitationhw
ETSI ETSI EN 300 718-1 V2.1.1 (2018-01) 7 1 Scope qhewpresentwdocumentwspecifieswtechnicalwcharacteristicswandwmethodswofwmeasurementswforwavalanchewbeaconswoperatingwatw4oqwkezwtransmittergreceiverwsystemshwklqbtwqhewrelationshipwbetweenwthewpresentwdocumentwandwessentialwrequirementswofwarticlewmhlwofwairectivewljk4iomibrwxihkzwiswgivenwinwannexwAhw2 References 2.1 Normative references oeferenceswarewspecificfwidentifiedwbywdatewofwpublicationwandiorweditionwnumberworwversionwnumberhwlnlywthewcitedwversionwapplieshwoeferencedwdocumentswwhichwarewnotwfoundwtowbewpubliclywavailablewinwthewexpectedwlocationwmightwbewfoundwatwhttpstiidocboxhetsihorgioeferenceihwklqbtwthilewanywhyperlinkswincludedwinwthiswclausewwerewvalidwatwthewtimewofwpublicationfwbqpfwcannotwguaranteewtheirwlongwtermwvalidityhwqhewfollowingwreferencedwdocumentswarewnecessarywforwthewapplicationwofwthewpresentwdocumenthwxkzwCfpmowkpgkgkwbljkoctw"ppecificationwforwradiowdisturbancewandwimmunitywmeasuringwapparatuswandwmethodswgwmartwkgktwoadiowdisturbancewandwimmunitywmeasuringwapparatuswgwjeasuringwapparatus"hwxlzwCfpmowkpgkg4wbljkjctw"martwkg4twoadiowdisturbancewandwimmunitywmeasuringwapparatuswgwAntennaswandwtestwsiteswforwradiatedwdisturbancewmeasurements"hwxmzwCfpmowkpgkgowbljk4ctw"ppecificationwforwradiowdisturbancewandwimmunitywmeasuringwapparatuswandwmethods;wmartwkgotwoadiowdisturbancewandwimmunitywmeasuringwapparatuswgwAntennawcalibrationwsiteswandwreferencewtestwsiteswforwowjezwtowkrwdez"hwx4zwbqpfwbkwmjjwqkrglwbslhkhkcwbjkgljkrctw"AvalanchewBeaconswoperatingwatw4oqwkez;wqransmittergreceiverwsystems;wmartwltwearmonisedwptandardwforwfeatureswforwemergencywservices"hw2.2 Informative references oeferenceswareweitherwspecificwbidentifiedwbywdatewofwpublicationwandiorweditionwnumberworwversionwnumbercworwnongspecifichwcorwspecificwreferencesfwonlywthewcitedwversionwapplieshwcorwnongspecificwreferencesfwthewlatestwversionwofwthewreferencedwdocumentwbincludingwanywamendmentscwapplieshwklqbtwthilewanywhyperlinkswincludedwinwthiswclausewwerewvalidwatwthewtimewofwpublicationfwbqpfwcannotwguaranteewtheirwlongwtermwvalidityhwqhewfollowingwreferencedwdocumentswarewnotwnecessarywforwthewapplicationwofwthewpresentwdocumentwbutwtheywassistwthewuserwwithwregardwtowawparticularwsubjectwareahwxihkzwairectivewljk4iomibrwofwthewburopeanwmarliamentwandwofwthewCouncilwofwkpwAprilwljk4wonwthewharmonisationwofwthewlawswofwthewjemberwptateswrelatingwtowthewmakingwavailablewonwthewmarketwofwradiowequipmentwandwrepealingwairectivewksssioibChwxihlzwCommissionwfmplementingwaecisionwCbljkocwomqpwfinalwofw4hrhljkowonwawstandardisationwrequestwtowthewburopeanwCommitteewforwblectrotechnicalwptandardisationwandwtowthewburopeanwqelecommunicationswptandardswfnstitutewaswregardswradiowequipmentwinwsupportwofwairectivewljk4iomibrwofwthewburopeanwmarliamentwandwofwthewCouncilhwxihmzwfqrwoadiowoegulationswbljklcfwAppendixwkwbobshtoCgklctw"Classificationwofwemissionswandwnecessarywbandwidths"hwSIST EN 300 718-1 V2.1.1:2018

ETSI ETSI EN 300 718-1 V2.1.1 (2018-01) 8 xih4zwbqpfwqowkjjwjlrwballwpartsctw"blectromagneticwcompatibilitywandwoadiowspectrumwjatterswbbojc;wrncertaintieswinwthewmeasurementwofwmobilewradiowequipmentwcharacteristics"hw3 Definitions, symbols and abbreviations 3.1 Definitions corwthewpurposeswofwthewpresentwdocumentfwthewfollowingwtermswandwdefinitionswapplyt avalanche beacons:wportablewradiowsystemswusedwforwlocatingwavalanchewvictimsfwforwthewpurposewofwdirectwrescuewklqbtwfhehwforwrescuewbywcomradeswnotwburiedwbywthewavalanchehwartificial antenna: tunedwreducedgradiatingwdummywloadwequalwtowthewnominalwimpedancewspecifiedwbywthewmanufacturerwconducted measurements: measurementswwhichwarewmadewusingwawdirectwconnectionwtowthewequipmentwunderwtestwE-field: electricwcomponentwofwthewfieldwmeasuredwaswvoltagewperwunitwlengthwenvironmental profile: rangewofwenvironmentalwconditionswunderwwhichwequipmentwwithinwthewscopewofwthewpresentwdocumentwiswrequiredwtowcomplywwithwthewprovisionswofwthewpresentwdocument H-field: magneticwcomponentwofwthewfieldwmeasuredwaswcurrentwperwunitwlengthwH-field test antenna: electricallywscreenedwloopworwequivalentwantennafwwithwwhichwthewmagneticwcomponentwofwthewfieldwcanwbewmeasuredwintegral antenna: antennawdesignedwaswanwindispensablewpartwofwthewequipmentfwwithworwwithoutwthewusewofwanwantennawconnectorwradiated measurements:wmeasurementswwhichwinvolvewthewabsolutewmeasurementwofwawradiatedwfieldw(S + N)/N:wratiofwexpressedwinwaecibelsfwbetweenwthewsumwofwthewwantedwsignalwpluswthewnoisewfloorwandwthewnoisewfloorw3.2 Symbols corwthewpurposeswofwthewpresentwdocumentfwthewfollowingwabbreviationswapplytwAkAwClasswofwemissionwklqbtwpeewfqrwoadiowoegulationswxihmzhwbwblectricalwfieldwstrengthwbowoeferencewelectricalwfieldwstrengthwklqbtwpeewannexwBhwfwcrequencywewjagneticwfieldwstrengthweowoeferencewmagneticwfieldwstrengthwklqbtwpeewannexwBhwkwkewtonwmwmowerwowaistancewoowoeferencewdistancewwklqbtwpeewannexwBhwtwqimewwwtavewimpedancewSIST EN 300 718-1 V2.1.1:2018

ETSI ETSI EN 300 718-1 V2.1.1 (2018-01) 9 lwtavelengthwklqbtwpeewannexwBhw3.3 Abbreviations corwthewpurposeswofwthewpresentwdocumentfwthewfollowingwabbreviationswapplytwocwoadiowcrequencyw4 Technical requirements specifications 4.1 Environmental profile qhewtechnicalwrequirementswofwthewpresentwdocumentwapplywunderwthewenvironmentalwprofilewforwoperationwofwthewequipmentfwwhichwshallwbewdeclaredwbywthewmanufacturerhwqhewequipmentwshallwcomplywwithwallwthewtechnicalwrequirementswofwthewpresentwdocumentwwhichwarewidentifiedwaswapplicablewinwannexwAwatwallwtimeswwhenwoperatingwwithinwthewboundarywlimitswofwthewdeclaredwoperationalwenvironmentalwprofilehw4.2 Conformance requirements for transmitters 4.2.1 Modulation and carrier keying 4.2.1.1 Definition qhewmodulationwiswthewmethodwforwgeneratingwthewocwcarrierhwqhewcarrierwkeyingwdefineswthewonwandwoffwtimeswforwawnongcontinuouswcarrierhw4.2.1.2 Method of measurement qhewcarrierwkeyingwshallwbewmeasuredwbywmeanswofwanwoscilloscopewconnectedwtowawsuitablewcoilwantennahwqhewmeasurementswshallwbewdonewunderwnormalwaswwellwaswunderwextremewtestwconditionshw4.2.1.3 Limits qhewmodulationwshallwbewofwtypewAkAfwihehwdoublewsidebandwamplitudewmodulationwwithwnowmodulatingwauxiliarywcarrierfwaswusedwforwtelegraphyhwqhewcarrierwkeyingwshallwbewaswshownwinwfigurewktw• onwtimetwqjwmswminimum;w• offwtimetw4jjwmswminimum;w• periodtwkwjjjwmsw±wmjjwmswbonwtimewpluswoffwtimechwSIST EN 300 718-1 V2.1.1:2018

ETSI ETSI EN 300 718-1 V2.1.1 (2018-01) 10 statuswonwoffwkwjjjw±wmjjwmsw≥w4jjwmsw ≥wqjwmswtimeww Figure 1 4.2.2 Frequency error 4.2.2.1 Definition qhewfrequencywerrorwofwthewtransmitterwsystemwiswthewdifferencewbetweenwthewmeasuredwcarrierwfrequencywandwthewnominalwcarrierwfrequencyhw4.2.2.2 Method of measurement qhewcarrierwfrequencywshallwbewmeasuredwbywmeanswofwawtestwfixturewbseewannexwBfwclausewBhkhlchwqhewmeasurementswshallwbewdonewunderwnormalwaswwellwaswunderwextremewtestwconditionswaswdefinedwinwclausewohw4.2.2.3 Limits qhewfrequencywerrorwshallwnotwexceedw±rjwezwatw4oqwkezhw4.2.3 Output field strength (H-field) 4.2.3.1 Definition qhewegfieldwiswmeasuredwinwthewdirectionwofwmaximumwfieldwstrengthwunderwspecifiedwconditionswofwmeasurementhw4.2.3.2 Method of measurement qhewegfieldwproducedwbywthewequipmentwshallwbewmeasuredwonwthewaxiswofwthewtransmittingwantennawatwdistanceswofwkjwmwonwanwoutdoorwtestwsitewbseewannexwBchw4.2.3.3 Limits 4.2.3.3.1 Minimum transmitted field qhewminimumwtransmittedwfieldwstrengthwatw4oqwkezwshallwnotwbewlowerwthanwgpwdBμAimwbjfowμAimcwatwawdistancewofwkjwmhw4.2.3.3.2 Maximum transmitted field qhewmaximumwtransmittedwfieldwstrengthwatw4oqwkezwshallwnotwexceedwqwdBμAimwblflmwμAimcwatwawdistancewofwkjwmh SIST EN 300 718-1 V2.1.1:2018

ETSI ETSI EN 300 718-1 V2.1.1 (2018-01) 11 4.2.4 Transmitter spurious emissions 4.2.4.1 Definition ppuriouswemissionswarewemissionswatwfrequencieswotherwthanwthosewofwthewcarrierwandwsidebandswassociatedwwithwnormalwmodulationhwqhewlevelwofwspuriouswemissionswshallwbewmeasuredwatwnormalwconditionswaswtheirweffectivewradiatedwpowerworwfieldwstrengthwradiatedwbywthewcabinetwandwthewintegralwantennahw4.2.4.2 Radiated H-field 4.2.4.2.1 Method of measurement (< 30 MHz) qhewfieldwstrengthwshallwbewmeasuredwforwfrequencieswbelowwmjwjezhwqhewequipmentwunderwtestwshallwbewmeasuredwatwawdistancewofwkjwmwonwanwoutdoorwtestwsitehwqhewtestwantennawshallwbewawcalibratedwshieldedwmagneticwfieldwantennahwqhewequipmentwunderwtestwandwtestwantennawshallwbewarrangedwaswstatedwinwannexwBfwclausewBhlhwqhewequipmentwunderwtestwshallwbewswitchedwonwinwtransmitwmodewbseewclausew4hlchwqhewmeasuringwreceiverwshallwbewtunedwoverwthewfrequencywrangewswkezwtowmjwjezfwexceptwforwthewfrequencywbandw±ljwkezwfromwthewfrequencywonwwhichwthewtransmitterwiswintendedwtowoperatehwAtweachwfrequencywatwwhichwawspuriouswsignalwiswdetectedwthewequipmentwunderwtestwandwthewtestwantennawshallwbewrotatedwuntilwmaximumwfieldwstrengthwiswindicatedwonwthewmeasuringwreceiverhwqhiswlevelwshallwbewnotedhwqhewlimitswarewquotedwinwdBμAworwdBμAimfwsowitwiswnecessarywtowreducewthewreadingwaswexplainedwinwannexwawforwmeasuringwequipmentwcalibratedwinwdBμsworwdBμsimhw4.2.4.2.2 Limits oadiatedwemissionswbelowwmjwjezwshallwnotwexceedwthewgeneratedwegfieldwatwkjwmwgivenwinwtablewlhwTable 2 State Frequency 9 kHz ≤ f < 10 MHz Frequency 10 MHz ≤ f < 30 MHz Transmit 27 dBμA/m descending 3 dB/oct -3,5 dBμA/m wAwgraphicalwrepresentationwiswshownwinwannexwCfwfigurewChkhw4.2.4.3 Effective radiated power 4.2.4.3.1 Method of measurement (≥ 30 MHz) lnwawtestwsitefwselectedwfromwannexwBfwthewequipmentwshallwbewplacedwatwthewspecifiedwheightwonwawnongconductingwsupportwandwinwthewpositionwclosestwtownormalwusewaswdeclaredwbywthewmanufacturerhwqhewtestwantennawshallwbeworientedwforwverticalwpolarizationhwqhewoutputwofwthewtestwantennawshallwbewconnectedwtowawmeasuringwreceiverhwqhewequipmentwshallwbewswitchedwonwinwtransmitwmodefwandwthewmeasuringwreceiverwshallwbewtunedwoverwthewfrequencywrangewmjwjezwtowkwjjjwjezhwAtweachwfrequencywatwwhichwawspuriouswcomponentwiswdetectedfwthewtestwantennawshallwbewraisedwandwloweredwthroughwthewspecifiedwrangewofwheightswuntilwawmaximumwsignalwlevelwiswdetectedwonwthewmeasuringwreceiverhwqhewequipmentwshallwthenwbewrotatedwthroughwmpj°winwthewhorizontalwplanefwuntilwthewmaximumwsignalwlevelwiswdetectedwbywthewmeasuringwreceiverhwqhewmaximumwsignalwlevelwdetectedwbywthewmeasuringwreceiverwshallwbewnotedhwqhewsubstitutionwantennawshallwbeworientedwforwverticalwpolarizationwandwcalibratedwforwthewfrequencywofwthewspuriouswcomponentwdetectedhwSIST EN 300 718-1 V2.1.1:2018

ETSI ETSI EN 300 718-1 V2.1.1 (2018-01) 12 qhewfrequencywofwthewcalibratedwsignalwgeneratorwshallwbewsetwtowthewfrequencywofwthewspuriouswcomponentwdetectedhwqhewinputwattenuatorwsettingwofwthewmeasuringwreceiverwshallwbewadjustedwinworderwtowincreasewthewsensitivitywofwthewmeasuringwreceiverfwifwnecessaryhwqhewtestwantennawshallwbewraisedwandwloweredwthroughwthewspecifiedwrangewofwheightswtowensurewthatwthewmaximumwsignalwiswreceivedhwthenwawtestwsitewaccordingwtowclausewBhmwiswusedfwtherewiswnowneedwtowvarywthewheightwofwthewantennahwqhewinputwsignalwtowthewsubstitutionwantennawshallwbewadjustedwuntilwanwequalworwawknownwrelatedwlevelwtowthatwdetectedwfromwthewtransmitterwiswobtainedwonwthewmeasuringwreceiverhwqhewinputwsignalwtowthewsubstitutionwantennawshallwbewrecordedwaswawpowerwlevelwandwcorrectedwforwanywchangewofwinputwattenuatorwsettingwofwthewmeasuringwreceiverhwqhewmeasurementwshallwbewrepeatedwwithwthewtestwantennawandwthewsubstitutionwantennaworientedwforwhorizontalwpolarizationhwqhewmeasurewofwtheweffectivewradiatedwpowerwofwthewspuriouswcomponentswiswthewlargerwofwthewtwowpowerwlevelswrecordedwforweachwspuriouswcomponentwatwthewinputwtowthewsubstitutionwantennafwcorrectedwforwthewgainwofwthewsubstitutionwantennawifwnecessaryhw4.2.4.3.2 Limits qhewpowerwofwanywradiatedwemissionwshallwnotwexceedwthewvalueswgivenwinwtablewmhwTable 3 State 47 MHz to 74 MHz
87,5 MHz to 118 MHz
174 MHz to 230 MHz
470 MHz to 862 MHz Other frequencies between 30 to 1 000 MHz Operating 4 nW 250 nW w4.3 Conformance requirements for receivers parameters 4.3.1 Receiver sensitivity 4.3.1.1 Definition qhewmaximumwusablewsensitivitywofwthewreceiverwiswthewminimumwlevelwofwthewsignalwbegfieldwstrengthcwatwthewnominalwfrequencywofwthewreceiverwwhichfwwhenwappliedwtowthewreceiverwinputwwithwnormalwtestwmodulationwbseewclausew4hlhkhmcfwproducesweitherwofwthewfollowingtw• awbpwewkcikwratiowofwpwdBfwmeasuredwatwthewterminalswofwthewelectroacousticwtransducerwforwbeaconswwithwanwacousticwsignalwindication;w• anwunambiguouswopticalwindicationwofwawreceivedwbeaconwsignalwforwbeaconswwithwopticalwsignalwindicationhw4.3.1.2 Method of measurement corwbeaconswwithwanwacousticwindicatorfwthewterminalswofwthewtransducerwshallwbewmadewaccessiblewforwthewpurposeswofwthewpresentwdocumenthwAwtestwsignalwatwawcarrierwfrequencywequalwtowthewnominalwfrequencywofwthewreceiverfwmodulatedwbywthewnormalwtestwmodulationwbseewclausew4hlcwshallwbewappliedwinwthewbestwcouplingwpositionfwihehwwhenwthewantennawrodwiswparallelwtowthewlineswofwthewmagneticwfieldhwAnwaudiowfrequencywloadwandwawmeasuringwinstrumentwforwmeasuringwthewpikwratiowshallwbewconnectedwtowthewterminalswofwthewelectroacousticwtransducerhwSIST EN 300 718-1 V2.1.1:2018

ETSI ETSI EN 300 718-1 V2.1.1 (2018-01) 13 qhewlevelwofwthewtestwsignalwshallwbewadjustedwuntilwawbpwewkcikwratiowofwpwdBwiswobtainedhwqhewbpwewkcikwratiowiswmeasuredwflatwoverwawbandwidthwofwljwkezhwqhewfieldwstrengthwatwthewreceiverwshallwbewmeasuredwbywawsubstitutionwmethodhwrnderwthesewconditionsfwthewlevelwofwthewtestwsignalwatwthewinputwiswthewvaluewofwthewreferencewmaximumwusablewsensitivitywwhichwshallwbewrecordedhwcorwbeaconswprovidingwopticalwindicationfwthewlevelwofwthewtestwsignalwshallwbewadjustedwuntilwanwunambiguouswindicationwofwthewpresencewofwawtransmitterwiswobtainedhwqhewfieldwstrengthwatwthewreceiverwshallwbewmeasuredwbywawsubstitutionwmethodhwrnderwthesewconditionsfwthewlevelwofwthewtestwsignalwatwthewinputwiswthewvaluewofwthewreferencewmaximumwusablewsensitivitywwhichwshallwbewrecordedhw4.3.1.3 Limits qhewappropriatewindicationwshallwbewachievedwforwawfieldwstrengthwnotwhigherwthanwrjwnAimwatwawfrequencywofw4oqwkezhw4.3.2 Receiver spurious emissions 4.3.2.1 Definition qhewlevelwofwspuriouswemissionswshallwbewmeasuredwatwnormalwconditionswaswtheirweffectivewradiatedwpowerworwfieldwstrengthwradiatedwbywthewcabinetwandwthewintegralwantennahw4.3.2.2 Radiated H-field 4.3.2.2.1 Method of measurement (< 30 MHz) qhewfieldwstrengthwshallwbewmeasuredwforwfrequencieswbelowwmjwjezhwqhewequipmentwunderwtestwshallwbewmeasuredwatwawdistancewofwkjwmwonwanwoutdoorwtestwsitehwqhewtestwantennawshallwbewawcalibratedwshieldedwmagneticwfieldwantennahwqhewequipmentwunderwtestwandwtestwantennawshallwbewarrangedwaswstatedwinwannexwBfwclausewBhkhwqhewequipmentwunderwtestwshallwbewswitchedwonwinwreceivewmodehwqhewmeasuringwreceiverwshallwbewtunedwoverwthewfrequencywrangewswkezwtowmjwjezhwAtweachwfrequencywatwwhichwawspuriouswsignalwiswdetectedwthewequipmentwunderwtestwandwthewtestwantennawshallwbewrotatedwuntilwmaximumwfieldwstrengthwiswindicatedwonwthewmeasuringwreceiverhwqhiswlevelwshallwbewnotedhwqhewlimitswarewquotedwinwdBμAworwdBμAimfwsowitwiswnecessarywtowreducewthewreadingwaswexplainedwinwannexwawforwmeasuringwequipmentwcalibratedwinwdBμsworwdBμsimhw4.3.2.2.2 Limits oadiatedwemissionswbelowwmjwjezwshallwnotwexceedwthewgeneratedwegfieldwatwkjwmwgivenwinwtablew4hwTable 4 State Frequency 9 kHz ≤ f < 10 MHz Frequency 10 MHz ≤ f < 30 MHz Receive 6 dBμA/m descending 3 dB/oct -24,5 dBμA/m wAwgraphicalwrepresentationwiswshownwinwannexwCfwfigurewChkhw4.3.2.3 Effective radiated power 4.3.2.3.1 Method of measurement (≥ 30 MHz) lnwawtestwsitefwselectedwfromwannexwBfwthewequipmentwshallwbewplacedwatwthewspecifiedwheightwonwawnongconductingwsupportwandwinwthewpositionwclosestwtownormalwusewaswdeclaredwbywthewmanufacturerhwqhewtestwantennawshallwbeworientedwforwverticalwpolarizationhwqhewoutputwofwthewtestwantennawshallwbewconnectedwtowawmeasuringwreceiverhwSIST EN 300 718-1 V2.1.1:2018

ETSI ETSI EN 300 718-1 V2.1.1 (2018-01) 14 qhewequipmentwshallwbewswitchedwonwinwreceivewmodefwandwthewmeasuringwreceiverwshallwbewtunedwoverwthewfrequencywrangewmjwjezwtowkwjjjwjezhwAtweachwfrequencywatwwhichwawspuriouswcomponentwiswdetectedfwthewtestwantennawshallwbewraisedwandwloweredwthroughwthewspecifiedwrangewofwheightswuntilwawmaximumwsignalwlevelwiswdetectedwonwthewmeasuringwreceiverhwqhewequipmentwshallwthenwbewrotatedwthroughwmpj°winwthewhorizontalwplanefwuntilwthewmaximumwsignalwlevelwiswdetectedwbywthewmeasuringwreceiverhwqhewmaximumwsignalwlevelwdetectedwbywthewmeasuringwreceiverwshallwbewnotedhwqhewsubstitutionwantennawshallwbeworientedwforwverticalwpolarizationwandwcalibratedwforwthewfrequencywofwthewspuriouswcomponentwdetectedhwqhewfrequencywofwthewcalibratedwsignalwgeneratorwshallwbewsetwtowthewfrequencywofwthewspuriouswcomponentwdetectedhwqhewinputwattenuatorwsettingwofwthewmeasuringwreceiverwshallwbewadjustedwinworderwtowincreasewthewsensitivitywofwthewmeasuringwreceiverfwifwnecessaryhwqhewtestwantennawshallwbewraisedwandwloweredwthroughwthewspecifiedwrangewofwheightswtowensurewthatwthewmaximumwsignalwiswreceivedhwthenwawtestwsitewaccordingwtowclausewBhmwiswusedfwtherewiswnowneedwtowvarywthewheightwofwthewantennahwqhewinputwsignalwtowthewsubstitutionwantennawshallwbewadjustedwuntilwanwequalworwawknownwrelatedwlevelwtowthatwdetectedwfromwthewreceiverwiswobtainedwonwthewmeasuringwreceiverhwqhewinputwsignalwtowthewsubstitutionwantennawshallwbewrecordedwaswawpowerwlevelwandwcorrectedwforwanywchangewofwinputwattenuatorwsettingwofwthewmeasuringwreceiverhwqhewmeasurementwshallwbewrepeatedwwithwthewtestwantennawandwthewsubstitutionwantennaworientedwforwhorizontalwpolarizationhwqhewmeasurewofwtheweffectivewradiatedwpowerwofwthewspuriouswcomponentswiswthewlargerwofwthewtwowpowerwlevelswrecordedwforweachwspuriouswcomponentwatwthewinputwtowthewsubstitutionwantennafwcorrectedwforwthewgainwofwthewsubstitutionwantennawifwnecessaryhw4.3.2.3.2 Limits qhewpowerwofwanywradiatedwemissionwshallwnotwexceedwthewvalueswgivenwinwtablewohwTable 5 State 30 MHz to 1 000 MHz Operating 2 nW w4.3.3 Receiver blocking oeceiverwblockingwiswnotwapplicablewforwavalanchewbeaconsfwduewtowpropagationwphysicswbihehwmagneticchwqhewoperatingwrangewofwavalanchewbeaconswiswverywsmallfwtypicallywpjwmwbthewminimumwrangewtowbewcompliantwtowthewstandardwiswaboutw4jwmchwAvalanchewbeaconswusewmagneticwantennashwqheywoperatewinwthewnearwfieldwbthewtransitionwnearwfieldwiwfarwfieldwiswatwlambdailpiwwwkj4wmchwfnwthewnearwfieldwthewmagneticwfieldwstrengthwvarieswwithwkirm;wthereforewavalanchewbeaconswreceiverwintrinsicallywneedwtowhandlewlargewsignalwstrengthwratiostwpjwmwiwkwmwcorrespondwtowawdynamicwrangewofwkjpwdBwatwleasthwqhiswiswtestedwindirectlywwithwclausew4h4hlwofwbqpfwbkwmjjwqkrglwx4zw"Changeswinwthewreceivedwsignal"hwSIST EN 300 718-1 V2.1.1:2018

ETSI ETSI EN 300 718-1 V2.1.1 (2018-01) 15 5 Test conditions, power sources and ambient temperatures 5.1 Normal and extreme test conditions qypewtestingwshallwbewmadewunderwnormalwtestwconditionsfwandwalsofwwherewstatedfwunderwextremewtestwconditionshwqhewtestwconditionswandwprocedureswshallwbewaswspecifiedwinwclauseswohlwtowoh4hw5.2 External test power source auringwtypewtestsfwthewpowerwsourcewofwthewequipmentwshallwbewreplacedwbywanwexternalwtestwpowerwsourcewcapablewofwproducingwnormalwandwextremewtestwvoltageswaswspecifiedwinwclauseswohmhlwandwoh4hlhwqhewinternalwimpedancewofwthewexternalwtestwpowerwsourcewshallwbewlowwenoughwforwitsweffectwonwthewtestwresultswtowbewnegligiblehwcorwthewpurposewofwthewtestsfwthewvoltagewofwthewexternalwtestwpowerwsourcewshallwbewmeasuredwatwthewinputwterminalswofwthewequipmenthwqhewnonggroundedwterminalwofwthewbatterieswshallwbewdisconnectedfwbutwbatterieswshallwbewleftwinwplacehwqhewexternalwtestwpowerwsourcewshallwbewsuitablywdegcoupledwandwappliedwaswclosewtowthewequipmentwbatterywterminalswaswpracticablehwqhewpowerwleadswshallwbewaswshortwaswpracticablewandwproperlywdressedhwcorwradiatedwmeasurementswfullywchargedwinternalwbatterieswshouldwbewusedhwqhewbatterieswusedwshouldwbewaswsuppliedworwrecommendedwbywthewmanufacturerhwauringwtestswthewexternalwtestwpowerwsourcewvoltageswshallwbewwithinwawtolerancew±kwBwrelativewtowthewvoltagewatwthewbeginningwofweachwtesthw5.3 Normal test conditions 5.3.1 Normal temperature and humidity qhewnormalwtemperaturewandwhumiditywconditionswforwtestswshallwbewanywconvenientwcombinationwofwtemperaturewandwhumiditywwithinwthewfollowingwrangestw• temperaturetweko°Cwtowemo°C;w• relativewhumiditytwljwBwtowqowBhwthenwitwiswimpracticablewtowcarrywoutwtestswunderwthesewconditionsfwawnotewtowthisweffectfwstatingwthewambientwtemperaturewandwrelativewhumiditywduringwthewtestsfwshallwbewaddedwtowthewtestwreporthw5.3.2 Normal test voltage qhewnormalwtestwvoltagewshallwbewdeclaredwbywthewmanufacturerhwqhewvalueswshallwbewstatedwinwthewtestwreporthw5.4 Extreme test conditions 5.4.1 Extreme temperatures qhewextremewoperatingwandwstoragewtemperatureswusedwforwthewtestswshallwbewthosewdeclaredwbywthewmanufacturerwforwthewequipmenthwqhewequipmentwshallwbewablewtowoperatewcorrectlywinwthewtemperaturewrangewfromwgljwtowe4o°Cwandwshallwbewstoredwwithoutwdamagewinwthewtemperaturewrangewfromwglowtoweqj°ChwSIST EN 300 718-1 V2.1.1:2018

ETSI ETSI EN 300 718-1 V2.1.1 (2018-01) 16 5.4.2 Extreme test voltages 5.4.2.1 General requirement qhewextremewtestwvoltageswshallwbewdeclaredwbywthewmanufacturerhw5.4.2.2 Procedure for tests at extreme temperatures Beforewmeasurementswarewmadewthewequipmentwshallwhavewreachedwthermalwbalancewinwthewtestwchamberhwqhewequipmentwshallwbewswitchedwoffwduringwthewtemperaturewstabilizingwperiodhwfnwthewcasewofwequipmentwcontainingwtemperaturewstabilizationwcircuitswdesignedwtowoperatewcontinuouslyfwthewtemperaturewstabilizationwcircuitswshallwbewswitchedwonwforwkowminuteswafterwthermalwbalancewhaswbeenwobtainedfwandwthewequipmentwshallwthenwmeetwthewspecifiedwrequirementshwffwthewthermalwbalancewiswnotwcheckedwbywmeasurementsfwawtemperaturewstabilizingwperiodwofwatwleastwonewhourfworwsuchwperiodwaswmaywbewdecidedwbywthewaccreditedwtestwlaboratoryfwshallwbewallowedhwqhewsequencewofwmeasurementswshallwbewchosenfwandwthewhumiditywcontentwinwthewtestwchamberwshallwbewcontrolledwsowthatwexcessivewcondensationwdoeswnotwoccurhw5.5 Measurement uncertainty qhewinterpretationwofwthewresultswrecordedwinwawtestwreportwforwthewmeasurementswdescribedwinwthewpresentwdocumentwshallwbewaswfollowstw• thewmeasuredwvaluewrelatedwtowthewcorrespondingwlimitwwillwbewusedwtowdecidewwhetherwanwequipmentwmeetswthewrequirementswofwthewpresentwdocument;w• thewvaluewofwthewmeasurementwuncertaintywforwthewmeasurementwofweachwparameterwshallwbewincludedwinwthewtestwreport;w• thewrecordedwvaluewofwthewmeasurementwuncertaintywshallwbefwforweachwmeasurementfwequalwtoworwlesswthanwthewfigureswinwtablewphwTable 6 Parameter Uncertainty RF frequency ±1 x 10-6 Radiated emission of transmitter, valid up to 1 GHz (Substitution method) ±2 dB Radiated emission of transmitter, valid up to 1 GHz (direct measurement, using calibrated antennas) ±6 dB Temperature ±1 °C Humidity ±5 % Transmitted H field at a distance of 10 m ±0,1 μA/m Carrier keying times ±3 ms NOTE: For the test methods according to the present document the uncertainty figures are valid to a confidence level of 95 % calculated according to the methods described in the ET
...

Questions, Comments and Discussion

Ask us and Technical Secretary will try to provide an answer. You can facilitate discussion about the standard in here.

Loading comments...