Stationary source emissions — Determination of the mass concentration of carbon monoxide, carbon dioxide and oxygen in flue gas — Performance characteristics of automated measuring systems

Émissions de sources fixes — Détermination de la concentration de monoxyde de carbone, de dioxyde de carbone et d'oxygène — Caractéristiques de fonctionnement et étalonnage de systèmes automatiques de mesure

Emisije nepremičnih virov – Določevanje ogljikovega monoksida, ogljikovega dioksida in kisika – Delovne karakteristike in kalibracija avtomatskih merilnih sistemov

General Information

Status
Withdrawn
Publication Date
27-Jun-2001
Withdrawal Date
27-Jun-2001
Current Stage
9599 - Withdrawal of International Standard
Start Date
22-Oct-2019
Completion Date
12-Feb-2026

Relations

Effective Date
25-Jun-2016
Standard

ISO 12039:2001 - Stationary source emissions -- Determination of the mass concentration of carbon monoxide, carbon dioxide and oxygen in flue gas -- Performance characteristics of automated measuring systems

English language
17 pages
sale 15% off
Preview
sale 15% off
Preview
Standard

ISO 12039:2001 - Émissions de sources fixes -- Détermination de la concentration de monoxyde de carbone, de dioxyde de carbone et d'oxygene -- Caractéristiques de fonctionnement et étalonnage de systemes automatiques de mesure

French language
17 pages
sale 15% off
Preview
sale 15% off
Preview

Get Certified

Connect with accredited certification bodies for this standard

NSF International

Global independent organization facilitating standards development and certification.

ANAB United States Verified

CIS Institut d.o.o.

Personal Protective Equipment (PPE) certification body. Notified Body NB-2890 for EU Regulation 2016/425 PPE.

SA Slovenia Verified

Kiwa BDA Testing

Building and construction product certification.

RVA Netherlands Verified

Sponsored listings

Frequently Asked Questions

ISO 12039:2001 is a standard published by the International Organization for Standardization (ISO). Its full title is "Stationary source emissions — Determination of the mass concentration of carbon monoxide, carbon dioxide and oxygen in flue gas — Performance characteristics of automated measuring systems". This standard covers: Stationary source emissions — Determination of the mass concentration of carbon monoxide, carbon dioxide and oxygen in flue gas — Performance characteristics of automated measuring systems

Stationary source emissions — Determination of the mass concentration of carbon monoxide, carbon dioxide and oxygen in flue gas — Performance characteristics of automated measuring systems

ISO 12039:2001 is classified under the following ICS (International Classification for Standards) categories: 13.040.40 - Stationary source emissions. The ICS classification helps identify the subject area and facilitates finding related standards.

ISO 12039:2001 has the following relationships with other standards: It is inter standard links to ISO 12039:2019. Understanding these relationships helps ensure you are using the most current and applicable version of the standard.

ISO 12039:2001 is available in PDF format for immediate download after purchase. The document can be added to your cart and obtained through the secure checkout process. Digital delivery ensures instant access to the complete standard document.

Standards Content (Sample)


2003-01.Slovenski inštitut za standardizacijo. Razmnoževanje celote ali delov tega standarda ni dovoljeno.OMLNRYHJDVLVWHPRYÉmissions de sources fixes -- Détermination de la concentration de monoxyde de carbone, de dioxyde de carbone et d'oxygène -- Caractéristiques de fonctionnement et étalonnage de systèmes automatiques de mesureStationary source emissions -- Determination of carbon monoxide, carbon dioxide and oxygen -- Performance characteristics and calibration of automated measuring systems13.040.40Stationary source emissionsICS:Ta slovenski standard je istoveten z:ISO 12039:2001SIST ISO 12039:2002en01-maj-2002SIST ISO 12039:2002SLOVENSKI
STANDARD
INTERNATIONALSTANDARDISO12039Firstedition2001-06-15ReferencenumberISO12039:2001(E)©ISO2001Stationarysourceemissions—Determinationofcarbonmonoxide,carbondioxideandoxygen—PerformancecharacteristicsandcalibrationofautomatedmeasuringsystemsÉmissionsdesourcesfixes—Déterminationdelaconcentrationdemonoxydedecarbone,dedioxydedecarboneetd'oxygène—CaractéristiquesdefonctionnementetétalonnagedesystèmesautomatiquesdemesureSIST ISO 12039:2002

ISO12039:2001(E)ii©ISO2001–AllrightsreservedPDFdisclaimerThisPDFfilemaycontainembeddedtypefaces.InaccordancewithAdobe'slicensingpolicy,thisfilemaybeprintedorviewedbutshallnotbeeditedunlessthetypefaceswhichareembeddedarelicensedtoandinstalledonthecomputerperformingtheediting.Indownloadingthisfile,partiesacceptthereintheresponsibilityofnotinfringingAdobe'slicensingpolicy.TheISOCentralSecretariatacceptsnoliabilityinthisarea.AdobeisatrademarkofAdobeSystemsIncorporated.DetailsofthesoftwareproductsusedtocreatethisPDFfilecanbefoundintheGeneralInforelativetothefile;thePDF-creationparameterswereoptimizedforprinting.EverycarehasbeentakentoensurethatthefileissuitableforusebyISOmemberbodies.Intheunlikelyeventthataproblemrelatingtoitisfound,pleaseinformtheCentralSecretariatattheaddressgivenbelow.©ISO2001Allrightsreserved.Unlessotherwisespecified,nopartofthispublicationmaybereproducedorutilizedinanyformorbyanymeans,elec-tronicormechanical,includingphotocopyingandmicrofilm,withoutpermissioninwritingfromeitherISOattheaddressbeloworISO'smem-berbodyinthecountryoftherequester.ISOcopyrightofficeCasepostale56•CH-1211Geneva20Tel.+41227490111Fax+41227490947E-mailcopyright@iso.chWebwww.iso.chPrintedinSwitzerlandSIST ISO 12039:2002

ISO12039:2001(E)©ISO2001–AllrightsreservediiiContentsPage1Scope.12Normativereferences.13Termsanddefinitions.24Symbols.45Principle.46Sampling.47Descriptionofthetestmethods.48Performancecharacteristics.89Finalreports.8AnnexADeterminationofperformancecharacteristics.10A.1General.10A.2Principle.10A.3Reagents.10A.4Testprocedures.11A.5Determinationofadditionalperformancecharacteristics.15Bibliography.17SIST ISO 12039:2002

ISO12039:2001(E)iv©ISO2001–AllrightsreservedForewordISO(theInternationalOrganizationforStandardization)isaworldwidefederationofnationalstandardsbodies(ISOmemberbodies).TheworkofpreparingInternationalStandardsisnormallycarriedoutthroughISOtechnicalcommittees.Eachmemberbodyinterestedinasubjectforwhichatechnicalcommitteehasbeenestablishedhastherighttoberepresentedonthatcommittee.Internationalorganizations,governmentalandnon-governmental,inliaisonwithISO,alsotakepartinthework.ISOcollaboratescloselywiththeInternationalElectrotechnicalCommission(IEC)onallmattersofelectrotechnicalstandardization.InternationalStandardsaredraftedinaccordancewiththerulesgivenintheISO/IECDirectives,Part3.DraftInternationalStandardsadoptedbythetechnicalcommitteesarecirculatedtothememberbodiesforvoting.PublicationasanInternationalStandardrequiresapprovalbyatleast75%ofthememberbodiescastingavote.AttentionisdrawntothepossibilitythatsomeoftheelementsofthisInternationalStandardmaybethesubjectofpatentrights.ISOshallnotbeheldresponsibleforidentifyinganyorallsuchpatentrights.InternationalStandardISO12039waspreparedbyTechnicalCommitteeISO/TC146,Airquality,SubcommitteeSC1,Stationarysourceemissions.AnnexAformsanormativepartofthisInternationalStandard.SIST ISO 12039:2002

ISO12039:2001(E)©ISO2001–AllrightsreservedvIntroductionCarbondioxide,carbonmonoxideandoxygenaregasesfoundintheexhaustgasesofcombustionprocesses.Determinationoftheconcentrationofthesegasesmayassisttheoperatorintheoptimizationofthecombustionprocess.ThedeterminationofO2andCO2isalsonecessarytonormalizethemeasuredconcentrationofothergasesandduststodefinedconditions.ThereareanumberofwaystomeasureconcentrationsofCO2,COandO2inducts.ThisInternationalStandarddescribesmethodsandequipmentforthemeasurementofconcentrationsofthesegases.SIST ISO 12039:2002

INTERNATIONALSTANDARDISO12039:2001(E)©ISO2001–Allrightsreserved1Stationarysourceemissions—Determinationofcarbonmonoxide,carbondioxideandoxygen—Performancecharacteristicsandcalibrationofautomatedmeasuringsystems1ScopeThisInternationalStandardspecifiestheprinciples,theessentialperformancecharacteristicsandthecalibrationofautomatedsystemsformeasuringcarbondioxide,carbonmonoxideandoxygeninthefluesofstationarysources.ThisInternationalStandardspecifiesextractiveandnon-extractivesystemsinconnectionwithseveraltypesofinstrumentalanalyser.Thefollowingtechniqueshaveprovidedthebasisforpracticalinstrumentation:—paramagnetism(O2);—magneticwind(O2);—differentialpressure(Quinke)(O2);—magnetodynamics;—zirconiumoxide(O2);—electrochemicalcell(O2andCO);—infraredabsorption(COandCO2).OtherequivalentinstrumentalmethodsmaybeusedprovidedtheymeettheminimumrequirementsproposedinthisInternationalStandard.Themeasuringsystemmaybecalibratedwithcertifiedgases,inaccordancewiththisInternationalStandard,orcomparablemethods.2NormativereferencesThefollowingnormativedocumentscontainprovisionswhich,throughreferenceinthistext,constituteprovisionsofthisInternationalStandard.Fordatedreferences,subsequentamendmentsto,orrevisionsof,anyofthesepublicationsdonotapply.However,partiestoagreementsbasedonthisInternationalStandardareencouragedtoinvestigatethepossibilityofapplyingthemostrecenteditionsofthenormativedocumentsindicatedbelow.Forundatedreferences,thelatesteditionofthenormativedocumentreferredtoapplies.MembersofISOandIECmaintainregistersofcurrentlyvalidInternationalStandards.ISO6145-2:—1),Gasanalysis—Preparationofcalibrationgasmixturesusingdynamicvolumetricmethods—Part2:VolumetricpumpsISO6879:1995,Airquality—PerformancecharacteristicsandrelatedconceptsforairqualitymeasuringmethodsISO10396:1993,Stationarysourceemissions—SamplingfortheautomateddeterminationofgasconcentrationsISO10849,Stationarysourceemissions—Determinationofthemassconcentrationofnitrogenoxides—Performancecharacteristicsofautomatedmeasuringsystems1)Tobepublished.SIST ISO 12039:2002

ISO12039:2001(E)2©ISO2001–Allrightsreserved3TermsanddefinitionsForthepurposesofthisInternationalStandard,thefollowingtermsanddefinitionsapply.3.1airpointvalueobtainedforO2whenairispassedthroughtheAMS3.2AutomatedMeasuringSystemAMSsystemthatcanbeattachedtoaducttocontinuouslymeasureandrecordthemassconcentrationsofCO,CO2,O2passingthroughtheduct3.3analyseranalyticalpartinanextractiveorinsituAMS3.4calibrationgasgasofknownandreliablecompositionthatcanbeusedtochecktheresponseoftheAMSandshouldbeusedforthecalibrationoftheAMS3.4.1spangasgasusedtoadjustandcheckaspecificpointonacalibrationcurve3.4.2zerogasgasorgasmixtureusedtoestablishthezeropointonacalibrationcurvewithinagivenconcentrationrange3.5calibrationsettingandcheckingoftheAMSwithasecondaryoraworkinggasbeforedeterminingtheperformancecharacteristicsandbeforebeginninganymeasurementofgasesNOTEThisprocedureshouldbecarriedoutateverycalibrationinterval.3.6calibrationintervalperiodoftimeduringwhichtheAMSwouldnormallybeusedbetweencalibrations,respectingtheindicationgiveninperiodsofunattendedoperation3.7comparativemeasurementsmeasurementstakenonthesameductinthesamesamplingplaneforthesameperiodoftimewiththeAMSundertestandwiththecomparativemethodatpointsashortdistancefromeachother,providingpairsofmeasuredvalues3.8comparativemethoddefinedtestmethodforobtainingcomparativemeasurementsofstationarysourceemissionscontainingCO,CO2andO2NOTEThiscanbeamanualmethodoranAMSwithadifferentmeasuringprinciple.3.9ductstackchimneyorfinalexitductonastationaryprocessusedforthedispersionofresidualprocessgasesSIST ISO 12039:2002

ISO12039:2001(E)©ISO2001–Allrightsreserved33.10massconcentrationconcentrationofasubstanceinanemittedwastegasexpressedasmasspervolumeNOTE1Massconcentrationisusuallyexpressedasmilligramspercubicmetre(mg/m3).NOTE2Theconversionofdatainppmtomg/m3canbecarriedoutasfollows:whereisthemolecularmass;istheactualtemperature,inkelvins;istheactualpressure,inpascals.3.11lagtimetimetakenfromasuddenchangeinconcentrationatthesamplingpointuntiltheinstrumentreadsofthecorrespondingchangeintheinstrumentresponse3.12linearitymaximumdeviationofthemeasuredconcentrationfromalinearcalibrationline3.13livezerooutputsignalofadevice,whichiscapableofpositiveandnegativeadjustmentaroundthezerovalue,thatisequivalenttotheminimuminputsignalEXAMPLEtooxygeninputtotheanalyserwithanoutputoftocapableofzeroadjustmentofuptowhenoxygenisappliedtotheinstrument.3.14periodofunattendedoperationperiodforwhichgivenvaluesofperformancecharacteristicsofaninstrumentcanbeguaranteedtoremainwithinprobabilitywithoutservicingoradjustmentNOTEForlong-termmonitoringinstallations,aminimumofsevendaysofunattendedoperationisrequired.3.15responsetimetimetakentoreachofthetotalchangeininstrumentresponseNOTEItisthecombinationoflagtimeandrise/falltime.3.16risetime(falltime)timetakentopassfromto(to)ofthetotalchangeininstrumentresponseNOTEForinstrumentswheretransientoscillationsoccurintheapproachtothefinalreading,thelattershouldbereplacedbythetimetakenfortheoscillationstofalltolessthanofthetotalchangeininstrumentreading.3.17verifiedAMSAMSpreviouslyverifiedagainstInternationalStandardISO12039mg/m3=(ppm)Mr22,4273Tp101,3MrTp10%0%10%4mA20mA3,2mA5mA0%95%90%10%90%90%10%10%SIST ISO 12039:2002

ISO12039:2001(E)4©ISO2001–Allrightsreserved4Symbolsisthestandarddeviation.ItisameasureoftheworkingprecisionoftheAMSandiscalculatedaccordingtotheusualformulaforstandarddeviations;isthestandarddeviationderivedfromthedifferenceinthepairsofmeasuredvaluesofCO,CO2andO2,bytheAMSundertestconditionandbyaequivalentmethod;isthestandarddeviationofthecomparativemethod;isthestandarddeviationofthepairedvalues;isthestandarddeviationoftheblankreadings.5PrincipleWithextractivesystems,arepresentativesamplegasistakenaccordingtoISO10396withasamplingprobeandconveyedtotheanalyserthroughthesamplelineandsample-gasconditioningsystem.Non-extractivesystemsdonotrequireanyremovalofsamplinggases.FortheinstallationitisessentialthatarepresentativeplaceinthestackbechoseninaccordancewithISO10396.ThesystemsdescribedinthisInternationalStandardmeasureCO2,COandO2concentrationsusinginstrumentalmethodsthatshallmeettheminimumperformancespecificationgiven.Extractivesystemsusuallygiveconcentrationsonadrybasisduetorequirementsforsampleconditioning,andnon-extractivesystemsusuallygiveconcentrationsonawetbasis.6SamplingSamplingandsample-gasconditioningsystemsforextractiveandnon-extractivemethodsshallconformtoISO10396.7Descriptionofthetestmethods7.1GeneralExamplesofthetypicalmethodsavailablearedescribedin7.2to7.5.Instrumentsthatusethesetypicaltechniquesshallmeettheperformancecharacteristicsasdescribedin7.2.4.7.2Infraredabsorptionmethod(CO/CO2)7.2.1PrincipleThenon-dispersiveinfraredabsorptionmethodisbasedontheprinciplethatgasesconsistingofmoleculeswithdifferentatomsabsorbinfraredradiationatauniquewavelength.Themeasurementtechniquemakesuseoftheprincipleasfollows:a)ParallelbeammethodRadiationfromaninfraredsourceisdividedintotwoparallelbeams,withonebeampassingthroughareferencecellandtheotherthroughasamplecell.Theseparatebeamintensitiesaremeasuredbyasuitabledetectortodeterminetheconcentrationofthegasofinterest.sAsscsDsx0SIST ISO 12039:2002

ISO12039:2001(E)©ISO2001–Allrightsreserved5b)SinglebeammethodTherearethreetypesofsinglebeammethod:—Useofinterferencefilters,withonefilterattheabsorptionbandforthegasbeingmeasuredandtheotherfilteratthereferencewavelength.Thegasconcentrationisthenafunctionoftheratioofthemeasuredandreferencewavelengths.—Gasfiltercorrelationinwhichthemeasurementinterferencefilterisreplacedwithagasfilter;otherwisethemethodissimilartoabove.Thisgivesbettersensitivityandrejectionofcross-sensitivityeffects.Additionalgasfilterstominimizeinterferinggasescanbeused.—Thesingle-beamsingle-wavelengthmethod,inwhichonlythemeasurementwavelengthisused.Theseanalysershavenocompensationforobscurationofthecell,source/detectorageing,etc.andtendtodriftbadly.Thisisovercomebyfrequentautocalibrations.c)FouriertransforminfraredspectroscopyAmovingmirrorisusedtogenerateanabsorptionspectrumofthesampleoverabroadregionoftheinfraredspectrum.Thismeasuredspectrumisevaluatedagainstestablishedlibraryspectratoderivetheconcentrationofthegaseousspeciesofinterest.7.2.2InstrumentapplicationTheinfraredabsorptionmethodforCO2analysisisapplicableforconcentrationsofCO2upto.ForCOanalysis,applicableconcentrationsarebetween(volumefraction)and(approximatelyvolumefraction).Itmaybenecessarytousemultiplecellstoachievethisrange.TheseconcentrationsarewithintherangeofconcentrationofCO2andCOintypicalcombustioneffluentstreamsanddetectablebymostinstrumentsavailableonthemarket.7.2.3Selectivity(interference)Selectivityshallbecheckedforeachapplicationofthismethod,asitwillvaryaccordingtothenatureofthesample.Potentiallyinterferingcomponentsarepresentinmanyenclosedgasstreamsandcanincludeparticles,watervapour,sulfurdioxide,nitrogenoxidesandhydrocarbons.7.2.4PerformancecharacteristicsPerformancecharacteristicsshallbeinaccordancewithclause8.7.3Paramagneticmethod(O2)7.3.1PrincipleOxygenisstronglyparamagneticandisattractedintoamagneticfield.Allothergases,withfewexceptions,areeitherweaklyparamagneticordiamagnetic.Thispropertycanbeusedtomakeananalysiswhichisspecifictooxygen.Therearethreebasicdetectiontechniquesthatcanbeused:a)Anelement,usuallyadumb-bellmountedonatorquesuspension,issuspendedinastrong,non-magneticfield.Oxygenmoleculesareattractedintothestrongestpartofthefield,forcingthedumb-bellfromitsequilibrium(zero)position.Theforcerequiredtoreturnthedumb-belltoitszeropositionisproportionaltotheoxygenconcentration.b)Asecondtechniqueusesthetemperaturecoefficientoftheparamagneticeffect.Theparamagneticcoefficientisinverselyproportionaltotheabsolutetemperature.Ifastrongmagneticfieldiscombinedwithatemperature20%6mg/m3510662500mg/m35%SIST ISO 12039:2002

ISO12039:2001(E)6©ISO2001–Allrightsreservedgradient,thenaflowofoxygengaswillbecreated.Therateofflow(magneticwind)isafunctionofoxygenconcentrationandcanbemeasured,forexamplebythermalconductivitytechniques.c)Thethirdtechniqueutilizesastrongmagneticfieldacrossatube.Oxygenmoleculeswillbeattractedintothefieldwhichthenactasimpedancetotheflowofareferencegas(usuallyN2)throughthetube.Thereductioninflowofthereferencegasisameasureoftheoxygenconcentration.7.3.2InstrumentapplicationTheparamagneticmethodforO2analysisisintendedforuseforoxygenconcentrationsintherangeuptovolumefraction,whichcoverstherequirementsofmostconventionalcombustionsystems.Paramagneticanalysersarecapableofmeasuringconcentrationsupto(pureoxygen).7.3.3SelectivitySelectivityshallbecheckedforeachapplicationofthetestmethod.Thismethodisonlysusceptibletointerferencefromgaseshavingstrongparamagneticproperties,suchasNOandNO2.Thesewillnotbepresentinquantitiesthatarelikelytoaffecttheapplicationofthismethodasappliedtocombustioneffluentstreams.EffectiveinterferencesshallbedeterminedinaccordancewithA.4.2.3.7.3.4PerformancecharacteristicsPerformancecharacteristicsshallbeinaccordancewithclause8.7.4Zirconiumoxidemethod(O2)7.4.1PrincipleThezirconiumoxidemethodmeasurestheexcessoxygeninafluegasusinganyttria-stabilizedzirconiumoxidecellwithporousplatinumelectrodescoatedonbothitsinnerandoutersurfaces.Whenthiscellisheatedtoahightemperature,above,itbecomespermeabletooxygenions.Vacanciesinitscrystallatticepermitthemobilityofoxygenionssothatthecellbecomesanoxygen-ion-conductingsolidelectrolyte.Theplatinumelectrodesoneachsideofthecellprovideacatalyticsurfaceforthechangeofoxygenmoleculestooxygenionsandoxygenionstooxygenmolecules.Oxygenmoleculesonthehigh-concentrationreference-gassideofthecellgainelectronstobecomeionsthatentertheelectrolyte.Simultaneously,attheotherelectrode,oxygenionsloseelectronsandarereleasedfromsurfaceoftheelectrodeasoxygenmolecules.Whentheconcentrationofoxygenisdifferentoneachsideofthecell,oxygenionsmigratefromthehighoxygen-concentrationsidetothelowoxygen-concentrationside.Thisionflowcreatesanelectronicimbalancethatresultsinavoltagepotentialbetweentheelectrodeswhichisafunctionofthetemperatureofthecellandtheratioofoxygenpartialpressureoneachsideofthecell.TheoutputvoltageasafunctionoftemperatureandoxygenconcentrationsinthesampleandreferencegasesisgivenbytheNernstequation:whereistheoutputvoltage;isthegasconstant;25%100%600CE=RT4FInp1p2ERSIST ISO 12039:2002

ISO12039:2001(E)©ISO2001–Allrightsreserved7istheabsolutetemperature;istheFaradayconstant;isthepartialpressureofO2inthereferencegas;isthepartialpressureofO2intheprocessgas.NOTEInpractice,certainzirconiumcellsmaynotexactlyfollowtheNernstequation.7.4.2InstrumentapplicationThezirconiumoxidemethodforO2analysisisintendedforuseforoxygenconcentrationsintherangeofuptovolumefraction,whichcoverstherequirementsofmostconventionalcombustionsystems.7.4.3SelectivityDuetothehightemperatureandpresenceofplatinuminthesensor,carbonmonoxideandhydrocarbonscanbeoxidized,givingastrongnegativeinterferenceiftheirconcentrationsareofthesameorderasoxygen.7.4.4PerformancecharacteristicsPerformancecharacteristicsshall
...


INTERNATIONAL ISO
STANDARD 12039
First edition
2001-06-15
Stationary source emissions —
Determination of carbon monoxide, carbon
dioxide and oxygen — Performance
characteristics and calibration of automated
measuring systems
Émissions de sources fixes — Détermination de la concentration de
monoxyde de carbone, de dioxyde de carbone et d'oxygène —
Caractéristiques de fonctionnement et étalonnage de systèmes
automatiques de mesure
Reference number
PDF disclaimer
This PDF file may contain embedded typefaces. In accordance with Adobe's licensing policy, this file may be printed or viewed but shall not be
edited unless the typefaces which are embedded are licensed to and installed on the computer performing the editing. In downloading this file,
parties accept therein the responsibility of not infringing Adobe's licensing policy. The ISO Central Secretariat accepts no liability in this area.
Adobe is a trademark of Adobe Systems Incorporated.
Details of the software products used to create this PDF file can be found in the General Info relative to the file; the PDF-creation parameters
were optimized for printing. Every care has been taken to ensure that the file is suitable for use by ISO member bodies. In the unlikely event
that a problem relating to it is found, please inform the Central Secretariat at the address given below.
All rights reserved. Unless otherwise specified, no part of this publication may be reproduced or utilized in any form or by any means, elec-
tronic or mechanical, including photocopying and microfilm, without permission in writing from either ISO at the address below or ISO's mem-
ber body in the country of the requester.
ISO copyright office
Case postale 56 • CH-1211 Geneva 20
Tel. + 41 22 749 01 11
Fax + 41 22 749 09 47
E-mail copyright@iso.ch
Web www.iso.ch
Printed in Switzerland
©
ii ISO 2001 – All rights reserved

Contents Page
1 Scope . 1
2 Normative references . 1
3 Terms and definitions . 2
4 Symbols . 4
5 Principle . 4
6 Sampling . 4
7 Description of the test methods . 4
8 Performance characteristics . 8
9 Final reports . 8
Annex
A Determination of performance characteristics . 10
A.1 General . 10
A.2 Principle . 10
A.3 Reagents . 10
A.4 Test procedures . 11
A.5 Determination of additional performance characteristics . 15
Bibliography. 17
©
ISO 2001 – All rights reserved iii

Foreword
ISO (the International Organization for Standardization) is a worldwide federation of national standards bodies (ISO
member bodies). The work of preparing International Standards is normally carried out through ISO technical
committees. Each member body interested in a subject for which a technical committee has been established has
the right to be represented on that committee. International organizations, governmental and non-governmental, in
liaison with ISO, also take part in the work. ISO collaborates closely with the International Electrotechnical
Commission (IEC) on all matters of electrotechnical standardization.
International Standards are drafted in accordance with the rules given in the ISO/IEC Directives, Part 3.
Draft International Standards adopted by the technical committees are circulated to the member bodies for voting.
Publication as an International Standard requires approval by at least 75 % of the member bodies casting a vote.
Attention is drawn to the possibility that some of the elements of this International Standard may be the subject of
patent rights. ISO shall not be held responsible for identifying any or all such patent rights.
International Standard ISO 12039 was prepared by Technical Committee ISO/TC 146, Air quality, Subcommittee
SC 1, Stationary source emissions.
Annex A forms a normative part of this International Standard.
©
iv ISO 2001 – All rights reserved

Introduction
Carbon dioxide, carbon monoxide and oxygen are gases found in the exhaust gases of combustion processes.
Determination of the concentration of these gases may assist the operator in the optimization of the combustion
process. The determination of O and CO is also necessary to normalize the measured concentration of other
2 2
gases and dusts to defined conditions. There are a number of ways to measure concentrations of CO , CO and O
2 2
in ducts. This International Standard describes methods and equipment for the measurement of concentrations of
these gases.
©
ISO 2001 – All rights reserved v

INTERNATIONAL STANDARD ISO 12039:2001(E)
Stationary source emissions — Determination of carbon monoxide,
carbon dioxide and oxygen — Performance characteristics and
calibration of automated measuring systems
1 Scope
This International Standard specifies the principles, the essential performance characteristics and the calibration of
automated systems for measuring carbon dioxide, carbon monoxide and oxygen in the flues of stationary sources.
This International Standard specifies extractive and non-extractive systems in connection with several types of
instrumental analyser. The following techniques have provided the basis for practical instrumentation:
— paramagnetism (O );
— magnetic wind (O );
— differential pressure (Quinke) (O );
— magnetodynamics;
— zirconium oxide (O );
— electrochemical cell (O and CO);
— infrared absorption (CO and CO ).
Other equivalent instrumental methods may be used provided they meet the minimum requirements proposed in this
International Standard.
The measuring system may be calibrated with certified gases, in accordance with this International Standard, or
comparable methods.
2 Normative references
The following normative documents contain provisions which, through reference in this text, constitute provisions of
this International Standard. For dated references, subsequent amendments to, or revisions of, any of these
publications do not apply. However, parties to agreements based on this International Standard are encouraged to
investigate the possibility of applying the most recent editions of the normative documents indicated below. For
undated references, the latest edition of the normative document referred to applies. Members of ISO and IEC
maintain registers of currently valid International Standards.
1)
ISO 6145-2:— , Gas analysis — Preparation of calibration gas mixtures using dynamic volumetric methods —
Part 2: Volumetric pumps
ISO 6879:1995, Air quality — Performance characteristics and related concepts for air quality measuring methods
ISO 10396:1993, Stationary source emissions — Sampling for the automated determination of gas concentrations
ISO 10849, Stationary source emissions — Determination of the mass concentration of nitrogen oxides —
Performance characteristics of automated measuring systems
1) To be published.
©
ISO 2001 – All rights reserved 1

3 Terms and definitions
For the purposes of this International Standard, the following terms and definitions apply.
3.1
air point
value obtained for O when air is passed through the AMS
3.2
Automated Measuring System
AMS
system that can be attached to a duct to continuously measure and record the mass concentrations of CO, CO ,O
2 2
passing through the duct
3.3
analyser
analytical part in an extractive or in situ AMS
3.4
calibration gas
gas of known and reliable composition that can be used to check the response of the AMS and should be used for
the calibration of the AMS
3.4.1
span gas
gas used to adjust and check a specific point on a calibration curve
3.4.2
zero gas
gas or gas mixture used to establish the zero point on a calibration curve within a given concentration range
3.5
calibration
setting and checking of the AMS with a secondary or a working gas before determining the performance
characteristics and before beginning any measurement of gases
NOTE This procedure should be carried out at every calibration interval.
3.6
calibration interval
period of time during which the AMS would normally be used between calibrations, respecting the indication given in
periods of unattended operation
3.7
comparative measurements
measurements taken on the same duct in the same sampling plane for the same period of time with the AMS under
test and with the comparative method at points a short distance from each other, providing pairs of measured values
3.8
comparative method
defined test method for obtaining comparative measurements of stationary source emissions containing CO, CO
and O
NOTE This can be a manual method or an AMS with a different measuring principle.
3.9
duct
stack chimney or final exit duct on a stationary process used for the dispersion of residual process gases
©
2 ISO 2001 – All rights reserved

3.10
mass concentration

concentration of a substance in an emitted waste gas expressed as mass per volume
NOTE 1 Mass concentration is usually expressed as milligrams per cubic metre (mg/m ).
NOTE 2 The conversion of data in ppm to mg/m can be carried out as follows:
� �
M 273 p
3 r
 mg/m = (ppm)� � �
22,4 T 101,3
where
M is the molecular mass;
r
T is the actual temperature, in kelvins;
p is the actual pressure, in pascals.
3.11
lag time
time taken from a sudden change in concentration at the sampling point until the instrument reads 10 % of the
corresponding change in the instrument response
3.12
linearity
maximum deviation of the measured concentration from a linear calibration line
3.13
live zero
output signal of a device, which is capable of positive and negative adjustment around the zero value, that is
equivalent to the minimum input signal
EXAMPLE 0 % to 10 % oxygen input to the analyser with an output of 4 mA to 20 mA capable of zero adjustment of 3,2 mA up
to5mA when0% oxygen is applied to the instrument.
3.14
period of unattended operation
period for which given values of performance characteristics of an instrument can be guaranteed to remain within
95 % probability without servicing or adjustment
NOTE For long-term monitoring installations, a minimum of seven days of unattended operation is required.
3.15
response time
time taken to reach 90 % of the total change in instrument response
NOTE It is the combination of lag time and rise/fall time.
3.16
rise time (fall time)
time taken to pass from 10 % to90 % (90 % to 10 %) of the total change in instrument response
NOTE For instruments where transient oscillations occur in the approach to the final reading, the latter should be replaced by the
time taken for the oscillations to fall to less than 10 % of the total change in instrument reading.
3.17
verified AMS
AMS previously verified against International Standard ISO 12039
©
ISO 2001 – All rights reserved 3

4 Symbols
s is the standard deviation. It is a measure of the working precision of the AMS and is calculated according to
A
the usual formula for standard deviations;
s is the standard deviation derived from the difference in the pairs of measured values of CO, CO and O ,by
2 2
the AMS under test condition and by a equivalent method;
s is the standard deviation of the comparative method;
c
s is the standard deviation of the paired values;
D
s is the standard deviation of the blank readings.
x0
5Principle
With extractive systems, a representative sample gas is taken according to ISO 10396 with a sampling probe and
conveyed to the analyser through the sample line and sample-gas conditioning system.
Non-extractive systems do not require any removal of sampling gases. For the installation it is essential that a
representative place in the stack be chosen in accordance with ISO 10396.
The systems described in this International Standard measure CO ,CO and O concentrations using instrumental
2 2
methods that shall meet the minimum performance specification given. Extractive systems usually give
concentrations on a dry basis due to requirements for sample conditioning, and non-extractive systems usually give
concentrations on a wet basis.
6 Sampling
Sampling and sample-gas conditioning systems for extractive and non-extractive methods shall conform to
ISO 10396.
7 Description of the test methods
7.1 General
Examples of the typical methods available are described in 7.2 to 7.5.
Instruments that use these typical techniques shall meet the performance characteristics as described in 7.2.4.
7.2 Infrared absorption method (CO/CO )
7.2.1 Principle
The non-dispersive infrared absorption method is based on the principle that gases consisting of molecules with
different atoms absorb infrared radiation at a unique wavelength. The measurement technique makes use of the
principle as follows:
a) Parallel beam method
Radiation from an infrared source is divided into two parallel beams, with one beam passing through a reference cell
and the other through a sample cell. The separate beam intensities are measured by a suitable detector to determine
the concentration of the gas of interest.
©
4 ISO 2001 – All rights reserved

b) Single beam method
There are three types of single beam method:
— Use of interference filters, with one filter at the absorption band for the gas being measured and the other filter at
the reference wavelength. The gas concentration is then a function of the ratio of the measured and reference
wavelengths.
— Gas filter correlation in which the measurement interference filter is replaced with a gas filter; otherwise the
method is similar to above. This gives better sensitivity and rejection of cross-sensitivity effects. Additional gas
filters to minimize interfering gases can be used.
— The single-beam single-wavelength method, in which only the measurement wavelength is used. These
analysers have no compensation for obscuration of the cell, source/detector ageing, etc. and tend to drift badly.
This is overcome by frequent autocalibrations.
c) Fourier transform infrared spectroscopy
A moving mirror is used to generate an absorption spectrum of the sample over a broad region of the infrared
spectrum. This measured spectrum is evaluated against established library spectra to derive the concentration of the
gaseous species of interest.
7.2.2 Instrument application
The infrared absorption method for CO analysis is applicable for concentrations of CO up to 20 %. For CO analysis,
2 2
3 −6 3
applicable concentrations are between 6 mg/m (5� 10 volume fraction) and 62 500 mg/m (approximately 5%
volume fraction). It may be necessary to use multiple cells to achieve this range.
These concentrations are within the range of concentration of CO and CO in typical combustion effluent streams
and detectable by most instruments available on the market.
7.2.3 Selectivity (interference)
Selectivity shall be checked for each application of this method, as it will vary according to the nature of the sample.
Potentially interfering components are present in many enclosed gas streams and can include particles, water
vapour, sulfur dioxide, nitrogen oxides and hydrocarbons.
7.2.4 Performance characteristics
Performance characteristics shall be in accordance with clause 8.
7.3 Paramagnetic method (O )
7.3.1 Principle
Oxygen is strongly paramagnetic and is attracted into a magnetic field. All other gases, with few exceptions, are
either weakly paramagnetic or diamagnetic. This property can be used to make an analysis which is specific to
oxygen.
There are three basic detection techniques that can be used:
a) An element, usually a dumb-bell mounted on a torque suspension, is suspended in a strong, non-magnetic field.
Oxygen molecules are attracted into the strongest part of the field, forcing the dumb-bell from its equilibrium
(zero) position. The force required to return the dumb-bell to its zero position is proportional to the oxygen
concentration.
b) A second technique uses the temperature coefficient of the paramagnetic effect. The paramagnetic coefficient is
inversely proportional to the absolute temperature. If a strong magnetic field is combined with a temperature
©
ISO 2001 – All rights reserved 5

gradient, then a flow of oxygen gas will be created. The rate of flow (magnetic wind) is a function of oxygen
concentration and can be measured, for example by thermal conductivity techniques.
c) The third technique utilizes a strong magnetic field across a tube. Oxygen molecules will be attracted into the
field which then act as impedance to the flow of a reference gas (usually N ) through the tube. The reduction in
flow of the reference gas is a measure of the oxygen concentration.
7.3.2 Instrument application
The paramagnetic method for O analysis is intended for use for oxygen concentrations in the range up to 25 %
volume fraction, which covers the requirements of most conventional combustion systems.
Paramagnetic analysers are capable of measuring concentrations up to 100 % (pure oxygen).
7.3.3 Selectivity
Selectivity shall be checked for each application of the test method. This method is only susceptible to interference
from gases having strong paramagnetic properties, such as NO and NO . These will not be present in quantities that
are likely to affect the application of this method as applied to combustion effluent streams. Effective interferences
shall be determined in accordance with A.4.2.3.
7.3.4 Performance characteristics
Performance characteristics shall be in accordance with clause 8.
7.4 Zirconium oxide method (O )
7.4.1 Principle
The zirconium oxide method measures the excess oxygen in a flue gas using an yttria-stabilized zirconium oxide cell
with porous platinum electrodes coated on both its inner and outer surfaces. When this cell is heated to a high
�
temperature, above 600 C, it becomes permeable to oxygen ions. Vacancies in its crystal lattice permit the mobility
of oxygen ions so that the cell becomes an oxygen-ion-conducting solid electrolyte.
The platinum electrodes on each side of the cell provide a catalytic surface for the change of oxygen molecules to
oxygen ions and oxygen ions to oxygen molecules. Oxygen molecules on the high-concentration reference-gas side
of the cell gain electrons to become ions that enter the electrolyte. Simultaneously, at the other electrode, oxygen
ions lose electrons and are released from surface of the electrode as oxygen molecules.
When the concentration of oxygen is different on each side of the cell, oxygen ions migrate from the high oxygen-
concentration side to the low oxygen-concentration side. This ion flow creates an electronic imbalance that results in
a voltage potential between the electrodes which is a function of the temperature of the cell and the ratio of oxygen
partial pressure on each side of the cell.
The output voltage as a function of temperature and oxygen concentrations in the sample and reference gases is
given by the Nernst equation:
� �
RT p
E = In
4F p
where
E is the output voltage;
R is the gas constant;
©
6 ISO 2001 – All rights reserved

T is the absolute temperature;
F is the Faraday constant;
in the reference gas;
p is the partial pressure of O
p is the partial pressure of O in the process gas.
NOTE In practice, certain zirconium cells may not exactly follow the Nernst equation.
7.4.2 Instrument application
The zirconium oxide method for O analysis is intended for use for oxygen concentrations in the range of up to 25 %
volume fraction, which covers the requirements of most conventional combustion systems.
7.4.3 Selectivity
Due to the high temperature and presence of platinum in the sensor, carbon monoxide and hydrocarbons can be
oxidized, giving a strong negative interference if their concentrations are of the same order as oxygen.
7.4.4 Performance characteristics
Performance characteristics shall be in accordance with clause 8.
7.5 Electrochemical cell method (O and CO)
7.5.1 Principle
Electrochemical cells can be used to measure O and CO if the electro-oxidation or electro-reduction of the gas
molecules at an electrode results in a current that is directly proportional to the partial pressure of the gas. In these
cells, the gas diffuses through a selective semipermeable membrane to an electrode and electrolytic solution. The
gas reacts at the electrode and a product of the reaction is transported to a counter-electrode where it, in turn, reacts.
The current generated from the difference in electromotive force (emf) from the cathode/anode reactions is
measured. A retarding potential can be maintained across the electrodes to prevent the oxidation of gas species that
might o
...


NORME ISO
INTERNATIONALE 12039
Première édition
2001-06-15
Émissions de sources fixes —
Détermination de la concentration de
monoxyde de carbone, de dioxyde de
carbone et d'oxygène — Caractéristiques
de fonctionnement et étalonnage de
systèmes automatiques de mesure
Stationary source emissions — Determination of carbon monoxide, carbon
dioxide and oxygen — Performance characteristics and calibration of
automated measuring systems
Numéro de référence
PDF — Exonération de responsabilité
Le présent fichier PDF peut contenir des polices de caractères intégrées. Conformément aux conditions de licence d'Adobe, ce fichier peut
être imprimé ou visualisé, mais ne doit pas être modifié à moins que l'ordinateur employé à cet effet ne bénéficie d'une licence autorisant l'uti-
lisation de ces polices et que celles-ci y soient installées. Lors du téléchargement de ce fichier, les parties concernées acceptent de fait la res-
ponsabilité de ne pas enfreindre les conditions de licence d'Adobe. Le Secrétariat central de l'ISO décline toute responsabilité en la matière.
Adobe est une marque déposée d'Adobe Systems Incorporated.
Les détails relatifs aux produits logiciels utilisés pour la création du présent fichier PDF sont disponibles dans la rubrique General Info du fi-
chier; les paramètres de création PDF ont été optimisés pour l'impression. Toutes les mesures ont été prises pour garantir l'exploitation de ce
fichier par les comités membres de l'ISO. Dans le cas peu probable où surviendrait un problème d'utilisation, veuillez en informer le Secréta-
riat central à l'adresse donnée ci-dessous.
Droits de reproduction réservés. Sauf prescription différente, aucune partie de cette publication ne peut être reproduite ni utilisée sous quel-
que forme que ce soit et par aucun procédé, électronique ou mécanique, y compris la photocopie et les microfilms, sans l'accord écrit de l'ISO
à l'adresse ci-après ou au comité membre de l'ISO dans le pays du demandeur.
ISO copyright office
Case postale 56 • CH-1211 Geneva 20
Tel. + 41 22 749 01 11
Fax + 41 22 749 09 47
E-mail copyright@iso.ch
Web www.iso.ch
ImpriméenSuisse
©
ii ISO 2001 – Tous droits réservés

Sommaire Page
1 Domaine d'application . 1
2 Références normatives . 1
3 Termes et définitions . 2
4 Symboles . 4
5 Principe . 4
6 Échantillonnage . 4
7 Description des méthodes d'essai . 4
8 Caractéristiques de fonctionnement . 8
9 Rapports finals . 8
Annexe
A Détermination des caractéristiques de fonctionnement . 10
A.1 Généralités . 10
A.2 Principe . 10
A.3 Réactifs . 11
A.4 Modes opératoires d'essai . 11
A.5 Détermination des caractéristiques de fonctionnement supplémentaires . 16
Bibliographie. 17
©
ISO 2001 – Tous droits réservés iii

Avant-propos
L'ISO (Organisation internationale de normalisation) est une fédération mondiale d'organismes nationaux de
normalisation (comités membres de l'ISO). L'élaboration des Normes internationales est en général confiée aux
comités techniques de l'ISO. Chaque comité membre intéressé par une étude a le droit de faire partie du comité
technique créé à cet effet. Les organisations internationales, gouvernementales et non gouvernementales, en liaison
avec l'ISO participent également aux travaux. L'ISO collabore étroitement avec la Commission électrotechnique
internationale (CEI) en ce qui concerne la normalisation électrotechnique.
Les Normes internationales sont rédigées conformément aux règles données dans les Directives ISO/CEI, Partie 3.
Les projets de Normes internationales adoptés par les comités techniques sont soumis aux comités membres pour
vote. Leur publication comme Normes internationales requiert l'approbation de 75 % au moins des comités membres
votants.
L'attention est appelée sur le fait que certains des éléments de la présente Norme internationale peuvent faire l'objet
de droits de propriété intellectuelle ou de droits analogues. L'ISO ne saurait être tenue pour responsable de ne pas
avoir identifié de tels droits de propriété et averti de leur existence.
La Norme internationale ISO 12039 a été élaborée par le comité technique ISO/TC 146,Qualitédel'air, sous-comité
SC 1, Émissions de sources fixes.
L'annexe A constitue un élément normatif de la présente Norme internationale.
©
iv ISO 2001 – Tous droits réservés

Introduction
Le dioxyde de carbone, le monoxyde de carbone et l'oxygène sont des gaz présents dans les gaz d'échappement
des procédés de combustion. La détermination de la concentration de ces gaz peut aider l'opérateur dans
l'optimisation du procédé de combustion. La détermination de l'O et du CO est également nécessaire pour
2 2
normaliser la concentration mesurée d'autres gaz et poussières dans des conditions définies. La mesure des
concentrations de CO ,deCO etd'O dans les conduits peut s'effectuer de plusieurs manières. La présente Norme
2 2
internationale décrit les méthodes et l'équipement pour le mesurage des concentrations de ces gaz.
©
ISO 2001 – Tous droits réservés v

NORME INTERNATIONALE ISO 12039:2001(F)
Émissions de sources fixes — Détermination de la concentration
de monoxyde de carbone, de dioxyde de carbone et d'oxygène —
Caractéristiques de fonctionnement et étalonnage de systèmes
automatiques de mesure
1 Domaine d'application
La présente Norme internationale spécifie les principes, les caractéristiques de fonctionnement essentielles et l'éta-
lonnage des systèmes automatiques de mesure pour le dioxyde de carbone, le monoxyde de carbone et l'oxygène
dans les conduites des sources fixes.
La présente Norme internationale spécifie les systèmes extractifs et non extractifs en rapport avec plusieurs types
d'analyseurs instrumentaux. Les techniques suivantes sont à la base des instruments de mesure utilisés dans la pra-
tique:
— le paramagnétisme (O );
— le vent magnétique (O );
— la pression différentielle (Quinke) (O );
— la magnétodynamique;
— l'oxyde de zirconium (O );
— la cellule électrochimique (O et CO);
— l'absorption des infrarouges (CO et CO ).
D'autres méthodes instrumentales équivalentes peuvent être utilisées à condition qu’elles satisfassent aux exigen-
ces minimales proposées dans la présente Norme internationale.
Le système de mesure peut être étalonné avec des gaz certifiés, conformément à la présente Norme internationale,
ou d’autres méthodes comparatives.
2 Références normatives
Les documents normatifs suivants contiennent des dispositions qui, par suite de la référence qui y est faite, consti-
tuent des dispositions valables pour la présente Norme internationale. Pour les références datées, les amendements
ultérieurs ou les révisions de ces publications ne s'appliquent pas. Toutefois, les parties prenantes aux accords fon-
dés sur la présente Norme internationale sont invitées à rechercher la possibilité d'appliquer les éditions les plus ré-
centes des documents normatifs indiqués ci-après. Pour les références non datées, la dernière édition du document
normatif en référence s'applique. Les membres de l'ISO et de la CEI possèdent le registre des Normes internationa-
les en vigueur.
1)
ISO 6145-2:— , Analyse des gaz — Préparation des mélanges de gaz pour étalonnage à l'aide de méthodes volu-
métriques dynamiques — Partie 2: Pompes volumétriques
ISO 6879:1995, Qualité de l'air — Caractéristiques de fonctionnement et concepts connexes pour les méthodes de
mesurage de la qualité de l'air
1) À publier.
©
ISO 2001 – Tous droits réservés 1

ISO 10396:1993, Émissions de sources fixes — Échantillonnage pour la détermination automatique des concentra-
tions de gaz
ISO 10849, Émissions de sources fixes — Détermination de la concentration en masse des oxydes d'azote — Ca-
ractéristiques de performance des systèmes de mesurage automatiques
3 Termes et définitions
Pour les besoins de la présente Norme internationale, les termes et définitions suivants s'appliquent.
3.1
point d'air
valeur obtenue pour O lorsque l'on fait passer de l'air par le système automatique de mesure
3.2
système automatique de mesure
AMS
système pouvant être fixé sur un conduit pour mesurer et enregistrer en continu les concentrations en masse du CO,
CO et de l'O passant par le conduit
2 2
3.3
analyseur
élément d'un AMS extractif ou in situ effectuant les analyses
3.4
gaz d'étalonnage
gaz de composition connue et fiable, qui peut être utilisé pour vérifier la réponse de l'AMS. Il convient de l'utiliser
pour l'étalonnage de l'AMS
3.4.1
gaz de gain
gaz utilisé pour régler et vérifier un point spécifique sur une courbe d’étalonnage
3.4.2
gaz de zéro
gaz ou mélange gazeux utilisé pour établir le zéro sur une courbe d'étalonnage dans une plage de concentrations
donnée
3.5
étalonnage
réglage et contrôle de l'AMS, avec un gaz secondaire ou un gaz de travail, avant de déterminer les caractéristiques
de fonctionnement et avant de commencer tout mesurage des gaz
NOTE Cette procèdure devrait être réalisée à tous les intervalles d’étalonnage.
3.6
intervalle d'étalonnage
durée pendant laquelle l'AMS est normalement utilisé entre chaque étalonnage, en respectant les indications
fournies en période de fonctionnement sans intervention
3.7
mesurage comparatif
mesurage effectué sur le même conduit du même plan d'échantillonnage, sur la même période de temps, avec l'AMS
soumis à essai et avec la méthode comparative, en des points à peu de distance les uns des autres et fournissant
des paires de valeurs mesurées
©
2 ISO 2001 – Tous droits réservés

3.8
méthode comparative
méthode d'essai définie pour les mesurages comparatifs des émissions de sources fixes contenant du CO, du CO
et de l'O
NOTE Il peut s'agir d'une méthode manuelle ou d'un AMS fonctionnant selon un principe de mesure différent.
3.9
conduit
gaine, cheminée ou conduit de rejet d'une source fixe d'émission servant à la dispersion des gaz résiduels du
processus
3.10
concentration en masse

concentration d'une substance dans un gaz d'échappement émis, exprimée en masse par volume
NOTE 1 La concentration en masse est habituellement exprimée en milligrammes par mètre cube (mg/m ).
NOTE 2 La conversion des données de ppm en mg/m peut être effectuée comme suit:
� �
M 273 p
3 r
 mg/m = (ppm)� � �
22,4 T 101,3
où
M est la masse moléculaire relative;
r
T est la température réelle, en kelvins;
p est la pression réelle, en pascals.
3.11
temps mort
temps écoulé entre une variation brusque de la concentration au point d'échantillonnage et le moment où
l'instrument indique 10 % de la variation correspondante dans la réponse de l'instrument
3.12
linéarité
écart maximal de la concentration mesurée par rapport à une ligne d'échantillonnage linéaire
3.13
zéro sous tension
signal de sortie d'un dispositif, capable d'un réglage positif et négatif autour de la valeur zéro, c'est-à-dire équivalant
au signal d'entrée minimum
EXEMPLE Une entrée d’oxygène de 0 % à 10 % dans l’analyseur avec une sortie de 4 mA à 20 mA capable d’un réglage du
zéro compris entre 3,2 mA et 5 mA lorsque 0 % d’oxygène est appliqué à l’instrument.
3.14
période de fonctionnement sans intervention
période pour laquelle les valeurs données des caractéristiques de fonctionnement d'un instrument peuvent être
garanties avec une probabilité de 95 %, sans entretien ni réglage
NOTE Pour les installations de surveillance à long terme, un fonctionnement sans intervention de sept jours au minimum est
requis.
3.15
temps de réponse
temps nécessaire pour atteindre 90 % de la variation totale de la réponse de l'instrument
NOTE C'est la combinaison temps mort — temps de montée/descente.
©
ISO 2001 – Tous droits réservés 3

3.16
tempsde montée(tempsde descente)
10 % 90 % 90 % 10 %
temps nécessaire pour passer de à ( à ) de la variation totale de la réponse de l'instrument
NOTE Pour les instruments où les oscillations transitoires surviennent à l'approche de la valeur finale lue sur l'instrument, il
convient de remplacer cette dernière par le temps nécessaire aux oscillations pour tomber à moins de 10 % de la variation totale
de la valeur lue sur l'instrument.
3.17
AMS vérifié
AMS préalablement vérifié conformément à la présente Norme internationale ISO 12039
4 Symboles
s
est l’écart-type. C’est une mesure de la fidélité de fonctionnement de l'AMS, et il est calculé selon la formule
A
usuelle des écarts-types;
s est l'écart-type issu de la différence entre les paires des valeurs mesurées du CO, du CO et de l'O donnée
2 2
par l'AMS en condition d'essai et par une méthode équivalente;
s est l’écart-type de la méthode comparative;
c
s est l’écart-type des paires de valeurs;
D
s est l’écart-type des lectures sur le blanc.
x0
5Principe
Avec les systèmes extractifs, un échantillon de gaz représentatif est prélevé conformément à l'ISO 10396 à l'aide
d'une sonde d'échantillonnage et transféré dans l'analyseur via la ligne d'échantillonnage et le système de condition-
nement du gaz échantillon.
Les systèmes non extractifs ne requièrent aucun retrait de gaz échantillon. Pour l'installation, il est essentiel qu'un
emplacement représentatif dans la gaine soit choisi conformément à l'ISO 10396.
Les systèmes décrits dans la présente Norme internationale mesurent les concentrations de CO ,deCO etdeO
2 2
en utilisant des méthodes instrumentales qui doivent satisfaire à la spécification de fonctionnement minimale indi-
quée. Les systèmes extractifs donnent généralement des concentrations sur une base sèche en raison des exigen-
ces relatives au conditionnement des échantillons, et les systèmes non extractifs donnent généralement des
concentrations sur une base humide.
6 Échantillonnage
L'échantillonnage et les systèmes de conditionnement des gaz échantillons pour les méthodes extractives et non ex-
tractives doivent être conformes à l'ISO 10396.
7 Description des méthodes d'essai
7.1 Généralités
Des exemples des méthodes types disponibles sont donnés de 7.2 à 7.5.
Les instruments qui utilisent ces techniques types doivent satisfaire aux caractéristiques de fonctionnement décrites
en 7.2.4.
©
4 ISO 2001 – Tous droits réservés

7.2 Méthode d’absorption des infrarouges (CO/CO )
7.2.1 Principe
La méthode d'absorption non dispersive des infrarouges se base sur le principe selon lequel les gaz constitués de
molécules avec des atomes différents absorbent le rayonnement infrarouge à une longueur d'onde unique. La
technique de mesurage utilise ce principe comme suit:
a) Méthode de faisceaux de rayons parallèles
Le rayonnement d'une source infrarouge est divisé en deux faisceaux de rayons parallèles, un faisceau traversant
une cellule de référence et l'autre faisceau traversant une cellule échantillon. Les intensités des faisceaux séparés
sont mesurées au moyen d'un détecteur approprié afin de déterminer la concentration de gaz du gaz étudié.
b) Méthode à simple faisceau
Il existe trois types de méthodes à simple faisceau:
— Utilisation de filtres à interférents, un filtre étant installé sur la bande d'absorption du gaz mesuré, l'autre filtre à
la longueur d'onde de référence. La concentration de gaz est alors fonction du rapport entre la longueur d'onde
mesurée et la longueur d'onde de référence.
— Corrélation du filtre à gaz, identique à celle donnée ci-dessus à ceci près que le filtre à interférents est remplacé
par un filtre à gaz. Elle donne une meilleure sensibilité et permet une meilleure élimination des effets de
sensibilité croisés. Des filtres à gaz supplémentaires peuvent être utilisés pour réduire au minimum les gaz
interférents.
— Méthode de longueur d'onde unique à simple faisceau, selon laquelle seule la longueur d'onde de mesurage est
utilisée. Ces analyseurs ne disposent pas de compensation d'opacité de la cellule, du vieillissement de la
source/du détecteur, etc. et ont tendance à dériver considérablement. Ces problèmes sont résolus par de
fréquents auto-étalonnages.
c) Spectroscopie à infrarouge à transformée de Fourier
Un miroir mobile est utilisé pour générer un spectre d'absorption de l’échantillon sur une large plage du spectre
infrarouge. Le spectre obtenu est comparé aux spectres de référence pour obtenir la concentration des espèces
gazeuses étudiées.
7.2.2 Application des instruments
La méthode d'absorption des infrarouges pour l'analyse du CO peut s'appliquer lorsque les concentrations de CO
2 2
sont inférieures ou égales à 20 %. Pour l'analyse du CO, les concentrations pouvant être mesurées sont comprises
3 −6 3
entre 6 mg/m (5� 10 en fraction volumique) et 62 500 mg/m (environ 5% en fraction volumique). Il peut
s'avérer nécessaire d'utiliser des cellules multiples pour obtenir cette plage.
Ces concentrations se situent dans la plage de concentrations du CO et du CO dans des courants d'effluents de
combustion types et sont détectable par la plupart des instruments disponibles sur le marché.
7.2.3 Sélectivité (interférence)
La sélectivité doit être contrôlée pour chaque application de cette méthode, étant donné qu'elle varie en fonction de
la nature de l'échantillon. Les composants potentiellement interférents sont présents dans de nombreux courants de
gaz confinés. Il peut s’agir de particules, de vapeur d'eau, de dioxyde de soufre, d’oxydes d'azote et d’hydrocarbures.
7.2.4 Caractéristiques de fonctionnement
Les spécifications de fonctionnement doivent être conformes à celles indiquées à l'article 8.
©
ISO 2001 – Tous droits réservés 5

7.3 Méthode paramagnétique (O )
7.3.1 Principe
L'oxygène est fortement paramagnétique et est attiré par un champ magnétique. Tous les autres gaz, à peu
d'exceptions, sont soit faiblement paramagnétiques, soit diamagnétiques. Cette propriété peut être utilisée pour
effectuer une analyse qui soit spécifique à l'oxygène.
Trois techniques de détection de base peuvent être utilisées.
a) Emploi d’un élément, généralement une haltère montée sur une suspension de torsion, suspendu dans un fort
champ non magnétique. Les molécules d'oxygène sont attirées dans la zone la plus forte du champ, déplaçant
l'haltère de sa position d'équilibre. La force nécessaire pour remettre l'haltère dans sa position zéro est
proportionnelle à la concentration d'oxygène.
b) Utilisation du coefficient de température de l'effet paramagnétique. Le coefficient paramagnétique est
inversement proportionnel à la température absolue. Si un fort champ magnétique est combiné à un gradient de
température, un flux d'oxygène est généré. Le débit du flux (le vent magnétique) est fonction de la concentration
d'oxygène et peut être mesuré, par exemple, par des techniques de conductivité thermique.
c) Emploi d’un fort champ magnétique au travers d'un tube. Les molécules d'oxygène sont attirées dans le champ
qui agit alors en tant qu'impédance sur le débit d'un gaz de référence (généralement du N ) à travers le tube. La
réduction du débit du gaz de référence constitue une mesure de la concentration d'oxygène.
7.3.2 Application des instruments
La méthode paramagnétique pour l'analyse de l'O est prévue pour des concentrations en oxygène dans une plage
inférieure ou égale à 25 % en fraction volumique, qui couvre les exigences de la plupart des systèmes de
combustion classiques.
Les analyseurs paramagnétiques sont capables de mesurer des concentrations jusqu'à 100 % (oxygène pur).
7.3.3 Sélectivité
La sélectivité doit être contrôlée pour chaque application de la méthode d'essai. Cette méthode est sensible
uniquement à l'interférence des gaz ayant des propriétés paramagnétiques élevées comme le NO et le NO .Ces
gaz ne sont pas présents en quantités susceptibles d'affecter l'application de cette méthode telle qu'elle s'applique
aux courants d'effluents de combustion. Les interférences effectives doivent être déterminées selon A.4.2.3.
7.3.4 Caractéristiques de fonctionnement
Les caractéristiques de fonctionnement doivent être conformes à celles indiquées à l'article 8.
7.4 Méthode à l’oxyde de zirconium (O )
7.4.1 Principe
La méthode à l'oxyde de zirconium permet de mesurer l'oxygène en excès dans un gaz de combustion en utilisant
de l'oxyde de zirconium stabilisé à l’yttrium avec des électrodes en platine poreuses revêtues sur leurs surfaces
�
600 C
intérieures et extérieures. Lorsque cette cellule est chauffée à une température élevée, supérieure à , elle
devient perméable aux ions oxygène. Des lacunes dans le réseau cristallin permettent la mobilité des ions oxygène
de manière que la cellule devienne un électrolyte solide conducteur d'ions oxygène.
Les électrodes en platine placées de chaque côté de la cellule fournissent une surface catalytique pour la
transformation des molécules d'oxygène en ions oxygène (et inversement des ions oxygène en molécules oxygène).
Les molécules d'oxygène sur le côté de la cellule du gaz de référence à forte concentration ionisent et pénètrent
©
6 ISO 2001 – Tous droits réservés

dans l'électrolyte. Simultanément, sur l'autre électrode, les ions d'oxygène perdent des électrons et sont libérés de la
surface de l'électrode sous forme de molécules d'oxygène.
Lorsque la concentration en oxygène est différente de chaque côté de la cellule, les ions oxygène migrent vers le
côté où la concentration en oxygène est la plus faible. Ce déplacement d'ions entraîne un déséquilibre électronique
qui crée une différence de potentiel entre les électrodes. Cette différence de potentiel est fonction de la température
de la cellule et du rapport de la pression partielle d'oxygène de chaque côté de la cellule.
La tension de sortie, qui est fonction de la température et des concentrations en oxygène dans l'échantillon et le gaz
de référence, est donnée par l'équation de Nernst:
� �
RT p
E = In
4F p
où
E est la tension de sortie;
R estlaconstantedegaz;
T est la température absolue;
F est la constante de Faraday;
p est la pression partielle de l’O dans le gaz de référence;
p est la pression partielle de l’O dans le gaz du processus.
2 2
NOTE En pratique, il est possible que certaines cellules de zirconium ne respectent pas exactement l'équation de Nernst.
7.4.2 Application des instruments
La méthode à l'oxyde de zirconium pour l'analyse de l'O est prévue pour être utilisée lorsque les concentrations sont
dans la plage inférieure ou égale à 25 % en fraction volumique, qui couvre les exigences de la plupart des systèmes
de combustion classiques.
7.4.3 Sélectivité
Le monoxyde de carbone et les hydrocarbures peuvent, en raison d'une température élevée et de la présence de
platine dans le capteur, s'oxyder, entraînant une forte interférence négative si leur concentration est du même ordre
de grandeur que celle de l'oxygène.
7.4.4 Caractéristiques de fonctionnement
Les caractéristiques de fonctionnement doivent être conformes à celles indiquées à l'article 8.
7.5 Méthode aux cellules électrochimiques (O et CO)
7.5.1 Principe
Les cellules électrochimiques peuvent être utilisées pour mesurer l'O et le CO lorsque l'électro-oxydation et
l'électro-réduction des molécules de gaz sur une électrode résulte en un courant qui est directement proportionnel à
la pression partielle du gaz. Dans ces cellules, le gaz diffuse à travers une membrane semi-perméable sélective vers
une électrode et une solution électrolyte. Le gaz réagit au niveau de l'électrode et un produit de la réaction est
transporté vers une contre-électrode, où il réagit à son tour. Le courant généré par la différence de force
©
ISO 2001 – Tous droits réservés 7

électromotrice (fem) provenant des réactions cathode/anode est mesuré. Un potentiel retardateur p
...

Questions, Comments and Discussion

Ask us and Technical Secretary will try to provide an answer. You can facilitate discussion about the standard in here.

Loading comments...